PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.11G019900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family GRAS
Protein Properties Length: 544aa    MW: 60933.9 Da    PI: 6.3096
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.11G019900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2608.2e-801585352374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL  cA a+++g+++++q++L  l+elas++gd+++Rla++ ++AL ++l++  s++++++ p + ++ + +    +l  f+e+sP++
  Manes.11G019900.1.p 158 EDLLNPCAAAITTGNFSRVQHFLYVLHELASSAGDANHRLAFFGLQALTHHLSS--STTSASVGPISFTSIEPKFFQRSLLKFYEISPWF 245
                          57999************************************************9..77777787777775455555555555******** PP

                 GRAS  92 kfshltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleetgerLak 167
                           f + +aN+ Il+ +++e    + +Hi+D+++s+G+QWp+Ll+aL+ Rp ++pp +RiT+v +  ++               +   rL +
  Manes.11G019900.1.p 246 SFPNNIANSSILQILAQEldhkQSLHILDIGVSHGVQWPTLLEALTRRPgGPPPLVRITVVTATVENdqntdtpfsVGPPGDNFPPRLLN 335
                          *************999999888999************************55566******99866656767776666667788889**** PP

                 GRAS 168 fAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..ns.esFl 254
                          fA+++++++++n l    l++l+ + ++++p+E l+V+ +++lh+l    ++ ++er+e+L+++++++Pk vv++e++ad+  ns ++F+
  Manes.11G019900.1.p 336 FAKSMNINLQINRLDNIPLQKLNGQIINTNPEEILIVCAQFRLHHLN---HNNPDERTEFLRFLRDMEPKGVVLSENNADCscNScGDFA 422
                          *************8777*****************************8...67777789*******************98775444259** PP

                 GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                          ++f++ ++y ++++ds+++ +    + r + Er++++ e+ ++++++g++    +e +e+W er++++GF    ++e+a +  ++llrk+
  Manes.11G019900.1.p 423 TGFSRRVDYLWKFLDSTSSAF----KGRDSEERRVMEGEAAKALTNRGEM----NEGKERWCERMRRVGFVGEVFGEDAIDGGRALLRKY 504
                          *****************7775....5666666666777799999999998....9*********************************** PP

                 GRAS 345 k.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          + ++++++ee+++++ l Wk++p+ ++S W+
  Manes.11G019900.1.p 505 DsNWEMKIEEKDECVGLWWKGQPVSFCSLWK 535
                          *9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.431131514IPR005202Transcription factor GRAS
PfamPF035142.8E-77158535IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MTIEEPEPNL ISDHILDWLE DSASFLPSFF DDPSNYNSGD VNGCQWWNQT EEICQGLSST  60
TNTTLNAPSD PTSSNHQQPS NSSRKRGATG DPVPKTSQNH HQGKKQNHRI RISNEDQDGE  120
QVIEVVAGKR SYRKNKGNSK STGNNGNNGN NKEGRWAEDL LNPCAAAITT GNFSRVQHFL  180
YVLHELASSA GDANHRLAFF GLQALTHHLS SSTTSASVGP ISFTSIEPKF FQRSLLKFYE  240
ISPWFSFPNN IANSSILQIL AQELDHKQSL HILDIGVSHG VQWPTLLEAL TRRPGGPPPL  300
VRITVVTATV ENDQNTDTPF SVGPPGDNFP PRLLNFAKSM NINLQINRLD NIPLQKLNGQ  360
IINTNPEEIL IVCAQFRLHH LNHNNPDERT EFLRFLRDME PKGVVLSENN ADCSCNSCGD  420
FATGFSRRVD YLWKFLDSTS SAFKGRDSEE RRVMEGEAAK ALTNRGEMNE GKERWCERMR  480
RVGFVGEVFG EDAIDGGRAL LRKYDSNWEM KIEEKDECVG LWWKGQPVSF CSLWKLDMNM  540
KGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B5e-3815453584473Protein SHORT-ROOT
5b3h_B2e-3815453530419Protein SHORT-ROOT
5b3h_E2e-3815453530419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.11G019900.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021628504.10.0nodulation-signaling pathway 1 protein-like
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A2C9UXR00.0A0A2C9UXR0_MANES; Uncharacterized protein
STRINGcassava4.1_033118m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-173GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]