PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.10G033400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family B3
Protein Properties Length: 299aa    MW: 34408 Da    PI: 10.303
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.10G033400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3352.6e-1116100999
                          HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                   B3   9 dvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                           + ++g + +p +f++++++    s  ++l+ ++g  W ++l    ++ +++l++GW+eF+    L+ g  ++Fk+ ++s f  +v +f 
  Manes.10G033400.1.p  16 RTIREGKFQIPGEFLRKCKE--GLSSPVVLKLPDGAIWHLEL--LVCGHEVWLGNGWREFAGHYSLDFGHLILFKHLRDSIF--NVVIFG 99 
                          45566779**********63..35567***************..888889*************************9999999..776665 PP

                          S CS
                   B3  99 k 99 
                          +
  Manes.10G033400.1.p 100 R 100
                          5 PP

2B347.43.6e-15201292298
                          EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                   B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                          fk+ ++s++ k++++++p++f++++ +  +e+    + +   r + v+++   +sg+++l+ GW+ F+  n L+ gD+++F+l++++   
  Manes.10G033400.1.p 201 FKIVVRSYNWKHCNVTIPRRFFRRYIEHRAEH---AMLQVADRMYPVQFKPATSSGSITLSIGWRAFAAGNFLEGGDVCIFELIKNNIL- 286
                          69999********************5444444...455556699999998899******************************986555. PP

                          .EEEEE- CS
                   B3  92 lvvkvfr 98 
                           +v++fr
  Manes.10G033400.1.p 287 -KVTIFR 292
                          .898887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.7E-194101IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.81E-206101IPR015300DNA-binding pseudobarrel domain
CDDcd100176.66E-12798No hitNo description
PROSITE profilePS5086311.3358101IPR003340B3 DNA binding domain
SMARTSM010193.5E-139101IPR003340B3 DNA binding domain
PfamPF023625.7E-91599IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.5E-19193292IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.65E-18194292IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.547200294IPR003340B3 DNA binding domain
SMARTSM010197.2E-11201294IPR003340B3 DNA binding domain
PfamPF023621.6E-12201292IPR003340B3 DNA binding domain
CDDcd100174.32E-14201292No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MIMATEPHFF KIILHRTIRE GKFQIPGEFL RKCKEGLSSP VVLKLPDGAI WHLELLVCGH  60
EVWLGNGWRE FAGHYSLDFG HLILFKHLRD SIFNVVIFGR SATEIQYPCG RICAGKRRTQ  120
KPKREKNDYN QPPRKKRGKR SLFLQLPEGT RTDSAIYQGE KPMPVMYKMS DLALATLSRP  180
FSCNFQALQA VNSFSSEYPS FKIVVRSYNW KHCNVTIPRR FFRRYIEHRA EHAMLQVADR  240
MYPVQFKPAT SSGSITLSIG WRAFAAGNFL EGGDVCIFEL IKNNILKVTI FRDVYQNA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115136KRRTQKPKREKNDYNQPPRKKR
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.10G033400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021624763.10.0B3 domain-containing transcription factor VRN1-like
TrEMBLA0A2C9V2Z80.0A0A2C9V2Z8_MANES; Uncharacterized protein
STRINGcassava4.1_022637m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.17e-22B3 family protein