PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.10G033200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family B3
Protein Properties Length: 158aa    MW: 18070.8 Da    PI: 6.5008
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.10G033200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3521.2e-1655144296
                          EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                   B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                          fk+ +++d+l++ ++ +p +f+++h ++k+++++l++     r W vkl +  +s++  l +G  eF+++n L +gD++vF+l++r+   
  Manes.10G033200.1.p  55 FKKILQPDHLEHWNMNIPFSFVQKHLESKTQTVKLQIA---DRAWPVKLMFHPSSNMSCLCEGFCEFARENSLAVGDVCVFELIKRNVL- 140
                          467779******99***********7777776566655...5*****************************************987655. PP

                          .EEEE CS
                   B3  92 lvvkv 96 
                           +v++
  Manes.10G033200.1.p 141 -KVSF 144
                          .5555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.3E-2250148IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-2150146IPR015300DNA-binding pseudobarrel domain
CDDcd100172.61E-2053146No hitNo description
PROSITE profilePS5086311.09654148IPR003340B3 DNA binding domain
SMARTSM010196.8E-1355148IPR003340B3 DNA binding domain
PfamPF023621.5E-1455141IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MEEERQEQEQ EQEGKSGIQL LQQSCNSEQA LKASSSIIYP AIEASNNCIS QYPSFKKILQ  60
PDHLEHWNMN IPFSFVQKHL ESKTQTVKLQ IADRAWPVKL MFHPSSNMSC LCEGFCEFAR  120
ENSLAVGDVC VFELIKRNVL KVSFLKPSSW MDRKMVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A1e-144115135146B3 domain-containing transcription factor VRN1
4i1k_B1e-144115135146B3 domain-containing transcription factor VRN1
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.10G033200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021626403.11e-111B3 domain-containing transcription factor VRN1-like
RefseqXP_021626404.11e-111B3 domain-containing transcription factor VRN1-like
TrEMBLA0A2C9V4491e-112A0A2C9V449_MANES; Uncharacterized protein
STRINGcassava4.1_032875m6e-89(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.13e-15B3 family protein