PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.10G031300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family B3
Protein Properties Length: 463aa    MW: 53407.5 Da    PI: 10.1681
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.10G031300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B354.22.7e-179101199
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.se 89 
                          ffkv + +  + +  l +p++f++++g++   s  ++le +sgr+W+v+l  +k +++++l++GW+eF +   L  g f+vF++++r   
  Manes.10G031300.1.p   9 FFKVILDETIHDK-KLGIPRRFVRKYGKD--LSSPVVLEVPSGRTWQVEL--KKWDDEIWLQNGWQEFLEYYSLTHGFFLVFEYTKRnCH 93 
                          6666655555554.59**********977..6667***************..999999***************************88677 PP

                          E..EEEEE-S CS
                   B3  90 felvvkvfrk 99 
                          f  +v +f+k
  Manes.10G031300.1.p  94 F--NVIIFDK 101
                          7..9999987 PP

2B361.71.2e-19231335199
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE......EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-. CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy....rkksgryvltkGWkeFvkangLkegDfvvFkld. 85 
                          f+ ++ ps+v+    l +  +fa ++  kk++s + tl  ++grsW vk+      ++ +++  +++GW++F+k+n+L++gD++ F+l+ 
  Manes.10G031300.1.p 231 FLVAMQPSYVHPAVKLNIQARFAVKYFPKKRQSGDATLHGLDGRSWPVKFYLynraCNEKRMAKISQGWRNFAKDNHLEVGDVCAFELIm 320
                          6788999******9************8899999*****************4368888888889************************665 PP

                          .SSSEE..EEEEE-S CS
                   B3  86 .grsefelvvkvfrk 99 
                           ++s++++ v++fr+
  Manes.10G031300.1.p 321 iKSSKATFQVTIFRH 335
                          46699999***9997 PP

3B356.74.4e-18366460199
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          ffkv +++ + +++++++p kf+ +++++++e+++l++e+   r W vkl+   + g+  +t+GW+ Fv+ n Lk+gD+++F+l+++++ 
  Manes.10G031300.1.p 366 FFKVVISPGSVENSNMCVPMKFI-SNMKQSTEKVKLQIEN---RWWLVKLNLYPQLGKGKFTDGWSAFVRGNSLKVGDVCIFELNNSENL 451
                          899999999999999********.6655656666666666...99*****9988888888************************999*** PP

                          ..EEEEE-S CS
                   B3  91 elvvkvfrk 99 
                          +l+v++fr+
  Manes.10G031300.1.p 452 QLKVTIFRN 460
                          *******96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.32E-242102IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-262102IPR015300DNA-binding pseudobarrel domain
CDDcd100171.06E-217100No hitNo description
PROSITE profilePS5086313.5358102IPR003340B3 DNA binding domain
SMARTSM010196.8E-169102IPR003340B3 DNA binding domain
PfamPF023622.1E-1410101IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.3E-24223335IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-22224335IPR015300DNA-binding pseudobarrel domain
CDDcd100172.84E-20229334No hitNo description
PROSITE profilePS5086314.085231336IPR003340B3 DNA binding domain
SMARTSM010192.3E-11231336IPR003340B3 DNA binding domain
PfamPF023621.3E-17231335IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.3E-18359459IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.12E-16364458IPR015300DNA-binding pseudobarrel domain
CDDcd100176.37E-17365459No hitNo description
PROSITE profilePS5086313.521366461IPR003340B3 DNA binding domain
PfamPF023623.3E-16366460IPR003340B3 DNA binding domain
SMARTSM010193.6E-12367461IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MFETDRPHFF KVILDETIHD KKLGIPRRFV RKYGKDLSSP VVLEVPSGRT WQVELKKWDD  60
EIWLQNGWQE FLEYYSLTHG FFLVFEYTKR NCHFNVIIFD KSASEIDYPI NVVTNGDFLE  120
GIQEPKIIQE TARDSSAETL EDFMPCRKRK EKSPLPSPLP HKMMKVENPT GNTALHFPGK  180
QDEGKRVDGE ISGQKQTSDT IVLRKKPLKA KEKNEALRRA STNFKSKNPF FLVAMQPSYV  240
HPAVKLNIQA RFAVKYFPKK RQSGDATLHG LDGRSWPVKF YLYNRACNEK RMAKISQGWR  300
NFAKDNHLEV GDVCAFELIM IKSSKATFQV TIFRHHRGKK QKLKDEESNS PEAIEAAKSF  360
TSVHPFFKVV ISPGSVENSN MCVPMKFISN MKQSTEKVKL QIENRWWLVK LNLYPQLGKG  420
KFTDGWSAFV RGNSLKVGDV CIFELNNSEN LQLKVTIFRN VK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1320445922141B3 domain-containing transcription factor VRN1
4i1k_B2e-1320445922141B3 domain-containing transcription factor VRN1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146151RKRKEK
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.10G031300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021624584.10.0B3 domain-containing transcription factor VRN1-like
TrEMBLA0A2C9V4320.0A0A2C9V432_MANES; Uncharacterized protein
STRINGcassava4.1_025209m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.14e-44B3 family protein