PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.10G008800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 171aa    MW: 18841.5 Da    PI: 6.6532
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.10G008800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.46.8e-4561051100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql
  Manes.10G008800.1.p   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPIHQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQL 95 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + +la++++e
  Manes.10G008800.1.p  96 QMQLAVAQAE 105
                          ******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0875106IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPIHQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEILCIQ MQNEPVVMMP  120
TPQMDDLDDA KSSSSFVFQN NHPQYLNFAS SSNVIHDSLK RESIFGDIIS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX2048014e-44JX204801.1 Jatropha curcas clone pJiSSR3369 microsatellite sequences.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002520780.11e-108PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW36e-78LBD12_ARATH; LOB domain-containing protein 12
TrEMBLB9S4611e-108B9S461_RICCO; LOB domain-containing protein, putative
STRINGPOPTR_0010s19180.11e-102(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-79LBD family protein