PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.10G005700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 229aa    MW: 24794.3 Da    PI: 8.9616
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.10G005700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.53.9e-42421411100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe +r da++slvyeA++r+rdPvyG++g i++lqqq+++l
  Manes.10G005700.1.p  42 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPEGQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQSL 131
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +ael+++++e
  Manes.10G005700.1.p 132 QAELNAVRAE 141
                          ******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.59541142IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-4242139IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MSRERERFDE IGKKIKRESD VSSQMGRRHM LGPPGTLNTI TPCAACKLLR RRCAQECPFS  60
PYFSPHEPQK FASVHKVFGA SNVSKMLMEV PEGQRADAAN SLVYEANVRL RDPVYGCMGA  120
ISALQQQVQS LQAELNAVRA EILKYKYREA NILPSSHVAL LSTGAVSVAA QSPSLPPPPT  180
TLPPPPPPPP PPPPLSPLSS SSSIYTHHQA TSATDYSTIS NENVSFFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-46341563125LOB family transfactor Ramosa2.1
5ly0_B5e-46341563125LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.10G005700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021625453.11e-167LOB domain-containing protein 15-like
SwissprotQ8L5T54e-85LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A2C9V3A61e-166A0A2C9V3A6_MANES; Uncharacterized protein
STRINGcassava4.1_029925m1e-166(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-86LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]