PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.09G106100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family Trihelix
Protein Properties Length: 265aa    MW: 31421.7 Da    PI: 8.3389
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.09G106100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix76.35e-2421103186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          +W+ qe+++ + +r+e+++++ ++k++k lW+ +s+k++e+gf+rs+ qCk+kw+nl +ryk ++++e +    + +++p++++l+
  Manes.09G106100.1.p  21 QWSIQETRQFLMIRSELDRTFMETKRNKLLWDVISNKLKEKGFHRSADQCKCKWKNLVTRYKGCETIEPES--LR-QQFPFYSELQ 103
                          7********************************************************************94..44.489****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122037.30E-222085No hitNo description
PfamPF138372.9E-2021105No hitNo description
PROSITE profilePS500907.2482278IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MEAHHHQHHI SVNVDTDRFP QWSIQETRQF LMIRSELDRT FMETKRNKLL WDVISNKLKE  60
KGFHRSADQC KCKWKNLVTR YKGCETIEPE SLRQQFPFYS ELQAIFSARM QRMLWTEAEG  120
AAGGSKKKAV QLCSDEEDDN EESEGEKLGS TRKKKKGKSA ANISGGGSSS GNIGSLKEIL  180
EDFMKQQMQM EMQWREAFEA RENERKMMEM EWRQTMEALE NERIMMDRRW REREEQRRIR  240
EEARAEKRDA LITALLHKLR REEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A2e-1218101386DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012087841.11e-121PREDICTED: trihelix transcription factor GT-3b
SwissprotQ9SDW05e-73TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A067JY091e-121A0A067JY09_JATCU; Uncharacterized protein
STRINGPOPTR_0006s10240.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.13e-51Trihelix family protein