PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.09G045600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 673aa    MW: 72894 Da    PI: 8.155
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.09G045600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093724091954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Manes.09G045600.1.p 372 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 409
                          554459******************************88 PP

2BELL126.31.1e-40236307172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqe+q+kkakL+s+l+eV++rY+qy++q+q+vissFe++ag+gsak Yt+lAl++iS++FrcLkdai++qi
  Manes.09G045600.1.p 236 ERQEIQMKKAKLISMLDEVEQRYRQYHHQMQIVISSFEQAAGIGSAKTYTALALQTISKQFRCLKDAITGQI 307
                          79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.0E-67160305IPR006563POX domain
PfamPF075263.2E-51165304IPR006563POX domain
PROSITE profilePS5007112.195350413IPR001356Homeobox domain
SMARTSM003895.3E-9353417IPR001356Homeobox domain
CDDcd000869.35E-12353414No hitNo description
SuperFamilySSF466898.55E-17354419IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.6E-29356419IPR009057Homeodomain-like
PfamPF059202.8E-18370409IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 673 aa     Download sequence    Send to blast
MATYFHGNPE IQAAAAASAE GLQTLVLMNP TYVQYSDTPP SSNNLLFLNS AANNLSSPPH  60
LSHAPPNTQQ FVGIPLDPNS HDTSTLHGLI PRIHYNLYNP VDPSSAARDT PRAQQGLSLS  120
LSSQQQPGYG SQAQAVSGED IRVSGGSASS GSGVTNNGVS GIQGVLLSSK YLKAAQELLD  180
EVVNVNNHGI KNELSKKSNG INSNNSNKVV GESSGGDGSA GGDAGGKRGA ELTTAERQEI  240
QMKKAKLISM LDEVEQRYRQ YHHQMQIVIS SFEQAAGIGS AKTYTALALQ TISKQFRCLK  300
DAITGQIKAA NKSLGEEDCL GGKIEGSRLK FVDHHLRQQR ALQQLGMIQH NAWRPQRGLP  360
ERSVSVLRAW LFEHFLHPYP KDSDKHMLAK QTGLTRSQVS NWFINARVRL WKPMVEEMYL  420
EEIKEQERNG SEDKSSKSEH NENSASKSVL QERGSVNENQ TKSFKSFDSS PNQNAPAISI  480
SAASTSPVAG NVRNHSGFSL IGSSELEGIT QGSPKRPRST ELIQSPTSVP SMDVKPGETN  540
NDQISMKFGN GRQSRDGYSF IGGQTNFIGG FGQYPIGELG RFDTEQFTPR FPGNAVSLTL  600
GLPHCENLSL SGTHQSFLPS QNIQLGRRVE IGEPNEFGGI NTSTPHSSTA YESINIQNRK  660
RFAAQLLPDF VA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16359416158Homeobox protein Meis1
4xrs_B2e-16359416158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002524053.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLB9SDI40.0B9SDI4_RICCO; Bel1 homeotic protein, putative
STRINGPOPTR_0006s21950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16273492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-159BEL1-like homeodomain 1