PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.09G025200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NF-YA
Protein Properties Length: 310aa    MW: 34783.1 Da    PI: 8.751
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.09G025200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.59.1e-33150206158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep+YVNaKQy++Il+RRq+Rak+e ekkl +k rkpylheSRh hA+rR+Rg+gGrF
  Manes.09G025200.1.p 150 EEPVYVNAKQYHGILRRRQSRAKAELEKKL-IKVRKPYLHESRHLHAMRRARGCGGRF 206
                          69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.5E-37148209IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.27149209IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.5E-28151206IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.3E-24152174IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860154174IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.3E-24183206IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MQMKLDNTSH PQLDPTNCMA SSKAWWHGVR SNVVLSDMLE ESTKNLLTSN YMDDGCGGKS  60
GKSRAANHQF GEGTDAYKEM QFTALPQSDG KYGEEHQQQH LQHSVSFMPP PMVEYLVPPT  120
QLEHVGPSLV HSCYLGAYPT RMVLPLEMTE EPVYVNAKQY HGILRRRQSR AKAELEKKLI  180
KVRKPYLHES RHLHAMRRAR GCGGRFINTK KLDNSAAKTT LDKANNFIDT VLKPSTNSSS  240
AHSSKRSDSS AGNVVIEPDH LHKQISQRTY NGGDGTACSQ YFLGFQLSSC HSQSDRMVEE  300
RDSNMKELW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-21150214266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.09G025200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021623103.10.0nuclear transcription factor Y subunit A-9-like isoform X1
SwissprotQ945M91e-35NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLA0A2C9V8Z00.0A0A2C9V8Z0_MANES; Uncharacterized protein
STRINGcassava4.1_012382m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2298744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.13e-37nuclear factor Y, subunit A9
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]