PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.08G092900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family Trihelix
Protein Properties Length: 266aa    MW: 31908.1 Da    PI: 8.7935
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.08G092900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix773e-2423105186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          +W+ qe+++ + +r e+++++ ++k++k lWe vs+km+e+gf rs++qCk+kw+nl +ryk ++++e +    + +++p++++l+
  Manes.08G092900.1.p  23 QWSIQETKEFLMIRAELDRTFMETKRNKLLWEVVSNKMKEKGFYRSAEQCKCKWKNLVTRYKGCETMETES--LR-QQFPFYNELQ 105
                          7********************************************************************94..44.489*****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122032.38E-212287No hitNo description
PfamPF138371.3E-2023107No hitNo description
PROSITE profilePS500906.9112480IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MEGYHHHQQH HISVNVDTDR FPQWSIQETK EFLMIRAELD RTFMETKRNK LLWEVVSNKM  60
KEKGFYRSAE QCKCKWKNLV TRYKGCETME TESLRQQFPF YNELQEIFGA RMQRMLWAEA  120
EGAAASSKKK AVQLSSDEED DNEESEGEKE SVRKKKKAKR TTNIGGGGGG SGNNNNIREI  180
LQDFMKQQMQ MEMQWREAFD ARENDRRLKE MEWRQKMEAL ENERIMMERR WREREEQRRI  240
REEARAEKRD ALITALLNKL RREEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A8e-1224103786DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264622.11e-120PREDICTED: trihelix transcription factor GT-3b-like
SwissprotQ9SDW01e-76TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLB9HCX71e-118B9HCX7_POPTR; Uncharacterized protein
STRINGPOPTR_0006s10240.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.12e-54Trihelix family protein