PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.08G033900.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 678aa    MW: 73723.1 Da    PI: 7.8744
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.08G033900.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093744111954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Manes.08G033900.3.p 374 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 411
                          554459******************************88 PP

2BELL126.31.1e-40238309172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqe+q+kkakL+s+l+eV++rY+qy++q+q+vissFe++ag+gsak Yt+lAl++iS++FrcLkdai++qi
  Manes.08G033900.3.p 238 ERQEIQMKKAKLISMLDEVEQRYRQYHHQMQIVISSFEQAAGIGSAKTYTALALQTISKQFRCLKDAITGQI 309
                          79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.8E-64161307IPR006563POX domain
PfamPF075264.4E-50166306IPR006563POX domain
PROSITE profilePS5007112.195352415IPR001356Homeobox domain
CDDcd000861.68E-11355415No hitNo description
SMARTSM003895.3E-9355419IPR001356Homeobox domain
SuperFamilySSF466895.99E-17356422IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-29358422IPR009057Homeodomain-like
PfamPF059202.8E-18372411IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MATYFHGNPE IQAAAAASAE GLQTLVLMNP TYVQYSDTPP PPPSNNLFFL NSAATNLSPS  60
PHLSHAPPSA QQFVGIPLDP SSHDTSTLHG LIPRIHYNLY NPVDPSSAAR ETPRAQQGLS  120
LSLSSQQQPG YRSQAQAVSG EDMRVSGGSV SSGSGVTNGV SGIQGMLLSS KYLKATQELL  180
DEVVNVNNNG IKNELSKKGN GISSNNSNKM IGESSGGDGS AGGDGGGKHG GAELTTAERQ  240
EIQMKKAKLI SMLDEVEQRY RQYHHQMQIV ISSFEQAAGI GSAKTYTALA LQTISKQFRC  300
LKDAITGQIK AANKSLGEED CLGGKLEGSR LKFVDNHIRQ QRALQQLGMI QHNAWRPQRG  360
LPERSVSVLR AWLFEHFLHP YPKDSDKHML AKQTGLTRSQ VSNWFINARV RLWKPMVEEM  420
YMEEMKEHER NGSEDKTSKS EQNESSASKS VLHEKGSVNE NQTKNFKSLD SSSNQNPPAI  480
SISTASTSPV SRNLRNHSGF SLIGSSELEG ITQQASPKRH RSTELIQSPT SVPSINMDVK  540
PGETNNEQIS MKFGNERQSR DGYSFIGSQT NFIGGFGQYP IGELGRFDTE QFTPRFSGNA  600
VSLTLGLPHC ENLSLSGTHQ NFLANQNIPL GRRVEIGELN DFGGINTSTP HSSSAYESIN  660
IQNPKRFAAQ LLPDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16361419563Homeobox protein Meis2
3k2a_B2e-16361419563Homeobox protein Meis2
4xrs_A2e-16361418158Homeobox protein Meis1
4xrs_B2e-16361418158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012074318.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_012074317.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_012074316.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_012074314.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A067KM800.0A0A067KM80_JATCU; Uncharacterized protein
STRINGPOPTR_0006s21950.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-169BEL1-like homeodomain 1