PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.07G113100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family B3
Protein Properties Length: 294aa    MW: 33925.8 Da    PI: 8.8718
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.07G113100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B354.12.9e-177991100
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          ffk+ + s   + + l +p+kf++++g+    s  ++l  +sg  W+v+l   k+ + ++l++GW++F +   L+ g f+vFk++g+ +f
  Manes.07G113100.1.p   7 FFKIILDSTIRQ-RKLAIPRKFVKKYGNC--LSSPVILSVPSGTIWRVEL--LKCNDDVWLGQGWQDFSNYYSLERGSFLVFKYEGECRF 91 
                          666665555555.55***********866..5557***************..99999****************************98999 PP

                          ..EEEEE-SS CS
                   B3  91 elvvkvfrks 100
                            +v +f+ks
  Manes.07G113100.1.p  92 --HVVIFDKS 99 
                          ..**999985 PP

2B353.25.3e-17199290298
                          EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                   B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                          f+vl++ ++ ++g++vlp +f+ +h + k++s  ++l++   r W vkli +  s r  +++GW+ F ++n +++gD +vF+l++r+   
  Manes.07G113100.1.p 199 FTVLMKRYHWENGIVVLPSSFFVRHFECKTQS--IMLQN-ADRFWPVKLISSSDSTRASFSAGWRVFSRENAIEVGDACVFELIKRNVL- 284
                          58999********************7666664..77666.88*******99999999**************************987666. PP

                          .EEEEE- CS
                   B3  92 lvvkvfr 98 
                           +v++fr
  Manes.07G113100.1.p 285 -NVTIFR 290
                          .888886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.8E-25399IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-24499IPR015300DNA-binding pseudobarrel domain
CDDcd100171.42E-19597No hitNo description
PROSITE profilePS5086313.719699IPR003340B3 DNA binding domain
SMARTSM010192.0E-17799IPR003340B3 DNA binding domain
PfamPF023624.6E-14798IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.7E-21194290IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-19195290IPR015300DNA-binding pseudobarrel domain
CDDcd100175.82E-16197290No hitNo description
SMARTSM010192.2E-13198292IPR003340B3 DNA binding domain
PROSITE profilePS5086312.576198292IPR003340B3 DNA binding domain
PfamPF023622.8E-14199290IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MENAPHFFKI ILDSTIRQRK LAIPRKFVKK YGNCLSSPVI LSVPSGTIWR VELLKCNDDV  60
WLGQGWQDFS NYYSLERGSF LVFKYEGECR FHVVIFDKSA SEIEYPYSNS HNANPNHDEL  120
QDIKIEENED DISVKALDVL SQCKKVEEKS TFLHPQSRKV MQSRCKKNDR RKVGRPPSFP  180
ITSQALEAAN NYVAKYPSFT VLMKRYHWEN GIVVLPSSFF VRHFECKTQS IMLQNADRFW  240
PVKLISSSDS TRASFSAGWR VFSRENAIEV GDACVFELIK RNVLNVTIFR CVD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.07G113100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021618011.10.0putative B3 domain-containing protein Os03g0621600
TrEMBLA0A2C9VMX10.0A0A2C9VMX1_MANES; Uncharacterized protein
STRINGcassava4.1_013029m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.12e-37B3 family protein