PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.07G102200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 217aa    MW: 23576 Da    PI: 6.4837
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.07G102200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.87.8e-43611601100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l
  Manes.07G102200.1.p  61 PCAACKILRRRCVEKCVLAPYFPPTEPYKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVNEL 150
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+la++++e
  Manes.07G102200.1.p 151 QAQLAKAQAE 160
                          *****99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.17260161IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-4361158IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MGNLDKAVAG ITPIAVPSPF SYSPPSSSPS LSSHSSLGLP SPSQSSPTAP PPPPPSVVLS  60
PCAACKILRR RCVEKCVLAP YFPPTEPYKF TIAHRVFGAS NIIKFLQELP ESQRADAVSS  120
MVYEANARIR DPVYGCAGAI CQLQKQVNEL QAQLAKAQAE VVNMQCQQAN LVALICMEMT  180
QSHHYQEPIF QQQQYIDTSC FLDDTNLATP WEPLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-436016810118LOB family transfactor Ramosa2.1
5ly0_B4e-436016810118LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.07G102200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021618102.11e-158LOB domain-containing protein 1-like
SwissprotQ9LQR01e-72LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A2C9VMK51e-157A0A2C9VMK5_MANES; Uncharacterized protein
STRINGcassava4.1_021199m1e-157(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-63LOB domain-containing protein 1