PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.07G038600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MIKC_MADS
Protein Properties Length: 230aa    MW: 26103.8 Da    PI: 7.511
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.07G038600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.21.8e-271868151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         k+i+n++ rqvtfskRr g++KKA+ELS+LCd+e+a+++fs tgkl+ey+s
  Manes.07G038600.1.p 18 KKIDNNTARQVTFSKRRRGLFKKAYELSTLCDVEIALMVFSATGKLFEYAS 68
                         68***********************************************86 PP

2K-box52.32.4e-18951801499
                K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                           +  + ++a L keie+  r++R++ Ge+L+ L+++eLqqLe+ Le+slk++ ++K e+l ++i+ l+    +l+een++L+k+++
  Manes.07G038600.1.p  95 LQLKNGNIAALSKEIEERIRQLRQMRGEELHGLNIEELQQLENLLERSLKRVSETKGEILANEINALKSEGAQLKEENERLKKQMM 180
                          5555667899999999999999*************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.1E-391069IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.5761070IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.45E-301182IPR002100Transcription factor, MADS-box
CDDcd002653.55E-391277No hitNo description
PROSITE patternPS0035001266IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-271232IPR002100Transcription factor, MADS-box
PfamPF003193.2E-251966IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-273247IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-274768IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.51495185IPR002487Transcription factor, K-box
PfamPF014861.2E-15100179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MSFDCLSLEM TRQKIQIKKI DNNTARQVTF SKRRRGLFKK AYELSTLCDV EIALMVFSAT  60
GKLFEYASSS MNQVIERRNL HPKNVGKLDQ TSLELQLKNG NIAALSKEIE ERIRQLRQMR  120
GEELHGLNIE ELQQLENLLE RSLKRVSETK GEILANEINA LKSEGAQLKE ENERLKKQMM  180
KERGGTMHLF EAGGQSSDSM ITNTSSSVDP AQDFEDSYTL LRLGLPFSD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-201275265MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-201275265MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-201275265MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-201275265MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A1e-201275265Myocyte-specific enhancer factor 2A
3kov_B1e-201275265Myocyte-specific enhancer factor 2A
3kov_I1e-201275265Myocyte-specific enhancer factor 2A
3kov_J1e-201275265Myocyte-specific enhancer factor 2A
3p57_A1e-201275265Myocyte-specific enhancer factor 2A
3p57_B1e-201275265Myocyte-specific enhancer factor 2A
3p57_C1e-201275265Myocyte-specific enhancer factor 2A
3p57_D1e-201275265Myocyte-specific enhancer factor 2A
3p57_I1e-201275265Myocyte-specific enhancer factor 2A
3p57_J1e-201275265Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY4865658e-74AY486565.1 Hevea brasiliensis clone mHbCIRa268 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012069198.11e-104PREDICTED: MADS-box protein SVP-like isoform X1
RefseqXP_012069197.11e-104PREDICTED: MADS-box protein SVP-like isoform X1
SwissprotQ9FUY65e-80JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLA0A067K1G21e-104A0A067K1G2_JATCU; Uncharacterized protein
STRINGVIT_00s0313g00070.t011e-80(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89033106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.19e-61MIKC_MADS family protein