PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.07G017600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family GeBP
Protein Properties Length: 400aa    MW: 44555.4 Da    PI: 5.8036
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.07G017600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573119.81.4e-37170266298
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          lfqrlwse+Dei++L+G+idf++k+g++ps+d++ f++f+kks++f+vs sql +K+ rLKkKf+++v+k k+g++++fsk+hdqk+f+l
  Manes.07G017600.1.p 170 LFQRLWSEDDEIAVLKGIIDFTKKKGTDPSKDMTSFHDFIKKSLHFDVSLSQLKDKVWRLKKKFENHVSKGKKGENKTFSKAHDQKSFDL 259
                          79**************************************************************************************** PP

               DUF573  92 skkiWgs 98 
                          skkiWgs
  Manes.07G017600.1.p 260 SKKIWGS 266
                          *****95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.1E-34171265IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MAPKRSTPLE DPPAASSSQE EESSSGEEDD GEEEEGSSSE EEETQGKPQK PSSQPASQIQ  60
TAKPVHKKPD SESESDESDS ESDSDDDRPN HARDATVKPI ASKPMEETPT KTTKPRSKPS  120
ASSPATAKST AAVKRASESD RDPKDSKRRK KKDSESDGVV EKSEDTKKQL FQRLWSEDDE  180
IAVLKGIIDF TKKKGTDPSK DMTSFHDFIK KSLHFDVSLS QLKDKVWRLK KKFENHVSKG  240
KKGENKTFSK AHDQKSFDLS KKIWGSEAIS GRGVDLGVKS NGKAKMNGGN NQRSKSFDTL  300
NAEQCLDVEK ETEKVDKMEV ETESHSGLKQ IVEFDRTASV AGMEEYVVKR GLDMLEGAKK  360
AEMEEKWRQL HVAELELFLK RNELIREQAK LMLAAYKTE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142148PKDSKRR
2147152RRKKKD
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.07G017600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021619093.10.0GLABROUS1 enhancer-binding protein-like
TrEMBLA0A2C9VHN30.0A0A2C9VHN3_MANES; Uncharacterized protein
STRINGcassava4.1_009078m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.16e-36DNA-binding storekeeper protein-related transcriptional regulator