PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.07G006600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NF-YA
Protein Properties Length: 343aa    MW: 37317.3 Da    PI: 8.9922
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.07G006600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.39e-32168224158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep+YVNaKQ+++Il+RRq+Rak+e ekk  +k+rkpylheSRh+hA+rR+Rg+gGrF
  Manes.07G006600.1.p 168 EEPVYVNAKQFHGILRRRQARAKAELEKKA-IKARKPYLHESRHQHAMRRARGCGGRF 224
                          69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.7E-36166227IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.811167227IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.9E-28169224IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.6E-24170192IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860172192IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.6E-24201224IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MPGKPDIGAH RLDQSAQSVL QSATYSQPWW QGVGNGPIFR ESPSKSSLVE HLNGSLADGS  60
IQSQANSGLD LESGENSNKD SHIAMASQSD GSNGQDHVKC VPMMAPVAMG GHLEPNPQME  120
LLGHSIVLAS YPYLDPQHGR ALSYAPQAMV PPRFLHHARM PLPLEMEEEP VYVNAKQFHG  180
ILRRRQARAK AELEKKAIKA RKPYLHESRH QHAMRRARGC GGRFLSTKKP QNNSTDHTAD  240
KDVNSGANPS QQSATFSGSE WLSKNNSRDL DSSSGLQEVK EYTSQETRDM QAQTSSNGNG  300
NGHGQSSIYH PSSGDILTGG FLSQQRKSTN WHGVTNAALR IN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-21168240271NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.07G006600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ9144406e-63HQ914440.1 Populus euphratica CCAAT-binding transcription factor subunit B mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021617504.10.0nuclear transcription factor Y subunit A-1-like
RefseqXP_021617505.10.0nuclear transcription factor Y subunit A-1-like
RefseqXP_021617506.10.0nuclear transcription factor Y subunit A-1-like
TrEMBLA0A2C9VHC20.0A0A2C9VHC2_MANES; Uncharacterized protein
STRINGcassava4.1_010627m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89623144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.48e-24nuclear factor Y, subunit A1