PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.07G000600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family HD-ZIP
Protein Properties Length: 371aa    MW: 40709.1 Da    PI: 7.7442
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.07G000600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.87.9e-18186240256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Manes.07G000600.1.p 186 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 240
                          788899***********************************************98 PP

2HD-ZIP_I/II1278.1e-41186276192
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr+++al+een+rL+ke +eLr +
  Manes.07G000600.1.p 186 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCEALTEENRRLNKELQELR-A 274
                          69*************************************************************************************9.5 PP

          HD-ZIP_I/II  91 lk 92 
                          lk
  Manes.07G000600.1.p 275 LK 276
                          55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046188.5E-729151IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.605.7E-17170236IPR009057Homeodomain-like
SuperFamilySSF466898.13E-18181243IPR009057Homeodomain-like
PROSITE profilePS5007116.714182242IPR001356Homeobox domain
SMARTSM003895.6E-15184246IPR001356Homeobox domain
CDDcd000868.00E-16186243No hitNo description
PfamPF000462.5E-15186240IPR001356Homeobox domain
PROSITE patternPS000270217240IPR017970Homeobox, conserved site
PfamPF021838.5E-11242276IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.1E-24242285IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MELGLSLGDA SKPFGCGEKS RDVSNRGSLG FCMALSIGPN QRQEQEHSHD NSTDTESTKI  60
NTPTHHRFSP VGPPLVQLHL LPNTPVQRSN HHHAFPWTSS ADNNNNNGSC EAAASGNLAR  120
GLDVNRLPAV EQAEDGAALS SSPPNSAASS FQMDFCIYSK KSGNYEAEIE RASSRASDED  180
ENGCARKKLR LSKEQSAFLE ESFKEHSTLN PKQKLALAKQ LNLRPRQVEV WFQNRRARTK  240
LKQTEVDCEY LKRCCEALTE ENRRLNKELQ ELRALKTSNP FYMQLPATTL TMCPSCERVA  300
TTSTATATTT TNATPSTTMK HASITNDNKD NDNNSDPTSK TIAAGLSLAR PLFYPFSHQT  360
QAIGHQPTSS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1234242RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.07G000600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1473521e-127EF147352.1 Populus trichocarpa clone WS0122_O02 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021617679.10.0homeobox-leucine zipper protein HOX11-like
SwissprotP466651e-92HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2C9VH580.0A0A2C9VH58_MANES; Uncharacterized protein
STRINGcassava4.1_028784m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-72homeobox from Arabidopsis thaliana