PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G173400.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 147aa    MW: 16009.2 Da    PI: 7.8116
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G173400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260147.92.6e-46131121100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lpe++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq+++l
  Manes.06G173400.2.p  13 PCAACKLLRRRCAHDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDSL 102
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +++la +++e
  Manes.06G173400.2.p 103 QTQLAIAQAE 112
                          *****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.17212113IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MKESGRKQGA LSPCAACKLL RRRCAHDCVF APYFPADEPQ KFASVHKVFG ASNVNKMLQE  60
LPEHQRSDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID SLQTQLAIAQ AEVVHMRMKQ  120
YGSSSNPGTM DLVIDQANAG ESMWSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-5191237121LOB family transfactor Ramosa2.1
5ly0_B2e-5191237121LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.06G173400.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021615135.11e-107LOB domain-containing protein 4 isoform X2
SwissprotQ9SHE92e-71LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A251KRH01e-105A0A251KRH0_MANES; Uncharacterized protein
STRINGcassava4.1_018537m1e-106(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-66LOB domain-containing protein 4