PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G168800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family EIL
Protein Properties Length: 578aa    MW: 64632.5 Da    PI: 5.982
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G168800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3431.86.6e-132333911341
                          XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                 EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasds 90 
                          eel++rmwkd+++lkr+ker+k ++  ++ a++++k +++++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd+
  Manes.06G168800.1.p  33 EELERRMWKDRIKLKRIKERQKFEV--QQ-AADKQKLKQTSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDN 119
                          8*******************99866..55.499********************************************************* PP

                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HH CS
                 EIN3  91 LraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelw 180
                          +raWWkekv+fd+ngpaai+ky+a++l++++++++  ++ + ++ l++lqD+tlgSLLs+lmqhcdppqr++plekgv+pPWWPtG+e+w
  Manes.06G168800.1.p 120 IRAWWKEKVKFDKNGPAAIAKYEAECLAMGEANKS--RKGNAQSVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGVSPPWWPTGNEEW 207
                          *****************************988888..789999*********************************************** PP

                          HHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX..... CS
                 EIN3 181 wgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss..... 265
                          w +lgl++ q+  pykkphdlkk+wkv+vL avikhmsp+i++ir+++rqsk+lqdkm+akes+++lsvl++ee++++++s+++      
  Manes.06G168800.1.p 208 WVKLGLPEGQS--PYKKPHDLKKMWKVGVLMAVIKHMSPDIAKIRRHVRQSKCLQDKMTAKESAIWLSVLSREESLIQQLSSDNGtsgit 295
                          *******9999..9*********************************************************************4445788 PP

                          ......XXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXX......XXXXX CS
                 EIN3 266 ......slrkqspkvtlsceqkedvegkkeskikhvqavktta...............gfpvvrkrkkkpsesakvsskevsrtcqssqf 334
                                + ++++++  +s+++++dv+  ++s  + ++++++++                 +v +k +  +++++k   ++ s+  q+s+ 
  Manes.06G168800.1.p 296 empqggHGERKRERPAVSSDSDYDVDAADDSVASVSSKDNRRNtatevepssivrtdnPHAVGDKEQ-GEEQRRKKPRQKSSQAGQQSEP 384
                          888887555678888899999*****88888888888888888889999999999996333333333.3333333333445566666666 PP

                          XX.XXXX CS
                 EIN3 335 rgsetel 341
                          ++++ ++
  Manes.06G168800.1.p 385 PRNKHSF 391
                          6666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.7E-12433279No hitNo description
Gene3DG3DSA:1.10.3180.101.7E-69155287IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.01E-59161282IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MGELVEIGAD ISSDIEVDDI AEKEVSDEEI EAEELERRMW KDRIKLKRIK ERQKFEVQQA  60
ADKQKLKQTS DQARRKKMSR AQDGILKYML KLMEVCKARG FVYGIIPEKG KPVSGSSDNI  120
RAWWKEKVKF DKNGPAAIAK YEAECLAMGE ANKSRKGNAQ SVLQDLQDAT LGSLLSSLMQ  180
HCDPPQRKYP LEKGVSPPWW PTGNEEWWVK LGLPEGQSPY KKPHDLKKMW KVGVLMAVIK  240
HMSPDIAKIR RHVRQSKCLQ DKMTAKESAI WLSVLSREES LIQQLSSDNG TSGITEMPQG  300
GHGERKRERP AVSSDSDYDV DAADDSVASV SSKDNRRNTA TEVEPSSIVR TDNPHAVGDK  360
EQGEEQRRKK PRQKSSQAGQ QSEPPRNKHS FIEEPVPDIN TADLSVGEYQ TNGTEQENDT  420
TAGLRPLQKG LESGPNLHQS EFNYFPAIPS ANVDSMRGTH AHRSSMFLCV SPNSELHNRV  480
AYDIYNPPVD YGPAHDAQQS QMTLDHAPEI RPLYDGGHIP ALQGDGNEII GGELHRPFGS  540
PPLLHNLSLE YGGIPSPYHF EIDEFLLDDE LIQCFGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A3e-741602909140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the ethylene response pathway. {ECO:0000269|PubMed:9215635, ECO:0000269|PubMed:9851977}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.06G168800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021616688.10.0ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A2C9VRP30.0A0A2C9VRP3_MANES; Uncharacterized protein
STRINGcassava4.1_004424m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-170ETHYLENE-INSENSITIVE3-like 3
Publications ? help Back to Top
  1. Frerigmann H,Gigolashvili T
    Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency.
    Front Plant Sci, 2014. 5: p. 626
    [PMID:25426131]
  2. Zheng ZL,Zhang B,Leustek T
    Transceptors at the boundary of nutrient transporters and receptors: a new role for Arabidopsis SULTR1;2 in sulfur sensing.
    Front Plant Sci, 2014. 5: p. 710
    [PMID:25566284]
  3. Panda SK,Sunkar R
    Nutrient- and other stress-responsive microRNAs in plants: Role for thiol-based redox signaling.
    Plant Signal Behav, 2015. 10(4): p. e1010916
    [PMID:25912823]
  4. WawrzyƄska A,Sirko A
    EIN3 interferes with the sulfur deficiency signaling in Arabidopsis thaliana through direct interaction with the SLIM1 transcription factor.
    Plant Sci., 2016. 253: p. 50-57
    [PMID:27968996]