PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G153000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB_related
Protein Properties Length: 305aa    MW: 33484.1 Da    PI: 9.6763
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G153000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.26.7e-125296147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                         r +W++ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Manes.06G153000.1.p 52 RESWSEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 96
                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-1546102IPR009057Homeodomain-like
PROSITE profilePS5129413.73747101IPR017930Myb domain
TIGRFAMsTIGR015575.0E-185099IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.5E-55192IPR009057Homeodomain-like
SMARTSM007171.4E-95199IPR001005SANT/Myb domain
PfamPF002499.7E-105296IPR001005SANT/Myb domain
CDDcd001672.31E-75497No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MVSKNPNQPD GFYLDPNGMA LPGLGPFVTA SATPSEDPSK KIRKPYTITK SRESWSEPEH  60
DKFLEALQLF DRDWKKIEAF VGSKTVIQIR SHAQKYFLKV QKSGTNEHLP PPRPKRKAAH  120
PYPQKATKNS PMLSQPPGSF HLLEPGLDGR PDSASIPMNP MNNASTASQT NNLPAVSLSN  180
QAKGANNCCS STENVSTMKP IGETAGLGNH GHRLRVLPDF AQVYNFIGSV FDPNATSHLQ  240
RLKKMDPIDV ETVLLLMRNL SINLTSPDFE DHRRLLSSYE IDTPAIGACK ILKDSLSKNV  300
AQFG*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.06G153000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021616866.10.0protein REVEILLE 6-like
SwissprotQ8H0W31e-121RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A2C9VR550.0A0A2C9VR55_MANES; Uncharacterized protein
STRINGcassava4.1_012567m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-109MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]