PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G145500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family HD-ZIP
Protein Properties Length: 809aa    MW: 88726.8 Da    PI: 6.3516
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G145500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.24.5e-21112167156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          ++k +++t++q++eLe++F+++++p++++r eL+++lgL+ +q+k+WFqNrR+++k
  Manes.06G145500.1.p 112 KKKYHRHTPNQIQELETFFKQCPHPDEKQRMELSRRLGLESKQIKFWFQNRRTQMK 167
                          79999************************************************999 PP

2START191.93.1e-603175392206
                          HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
                START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                          la++a++el+k a+ ++p+W+++    + ++ +e++++f++  +     + +ea r++g+v+ ++  l e+l+d++ +W e ++    ka
  Manes.06G145500.1.p 317 LALAAMDELIKIAQIDSPLWMTMDggkDALKHEEYMRTFSPCIGvkpssFVTEATRETGIVIINSLALAETLMDVN-RWLEAFPgliaKA 405
                          6899*********************9999***********99889***99**************************.************* PP

                          EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
                START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                          +t++vissg      galqlm ae+q++sp vp R + f+R+++q+ +g+w++vdvS+d +q+ ++s+s++ ++++pSg+++++++ng s
  Manes.06G145500.1.p 406 STIDVISSGvggtknGALQLMHAEFQVGSPFVPvRQVRFLRFCKQHAEGVWAVVDVSIDANQESSNSHSFAACRRFPSGCIMQDMPNGCS 495
                          ****************************************************************************************** PP

                          EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +vtwveh +++++ +h+l+rs+++sgla+ga++wvatlqr+ce+
  Manes.06G145500.1.p 496 RVTWVEHSEYDESAVHQLYRSVLSSGLAFGARRWVATLQRYCEC 539
                          ******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-2197163IPR009057Homeodomain-like
SuperFamilySSF466892.05E-2099169IPR009057Homeodomain-like
PROSITE profilePS5007117.848109169IPR001356Homeobox domain
SMARTSM003894.3E-18111173IPR001356Homeobox domain
PfamPF000461.3E-18112167IPR001356Homeobox domain
CDDcd000861.89E-19112169No hitNo description
PROSITE patternPS000270144167IPR017970Homeobox, conserved site
PROSITE profilePS5084841.388307542IPR002913START domain
SuperFamilySSF559613.96E-29308539No hitNo description
CDDcd088751.17E-113311538No hitNo description
SMARTSM002342.9E-44316539IPR002913START domain
PfamPF018525.5E-53317539IPR002913START domain
SuperFamilySSF559611.65E-19567802No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    Send to blast
MISNSSSVNS PGGGVSKIVA EIVTHRNTMH SGGIAHQPPV ITSSIPKSPA LSLSLKGTMD  60
SHGDMGLLGE HFDPSIAGRM KEDGYESKSG SDNLEGASGD DQEAGEDQRT QKKKYHRHTP  120
NQIQELETFF KQCPHPDEKQ RMELSRRLGL ESKQIKFWFQ NRRTQMKTQL ERHENIILRQ  180
ENDKLRAENE LLKQNMTDPI CNNCGSPVVP GPVSYEQQQL RIENARLNDE LGRVYALANK  240
FLGRPLSSSS GHVPPFDSNS KLDLSVGRNG YGGLGSIETS LPIGLDYSDG LTMPLMKPMT  300
SPMLNEVPYD RSLFIDLALA AMDELIKIAQ IDSPLWMTMD GGKDALKHEE YMRTFSPCIG  360
VKPSSFVTEA TRETGIVIIN SLALAETLMD VNRWLEAFPG LIAKASTIDV ISSGVGGTKN  420
GALQLMHAEF QVGSPFVPVR QVRFLRFCKQ HAEGVWAVVD VSIDANQESS NSHSFAACRR  480
FPSGCIMQDM PNGCSRVTWV EHSEYDESAV HQLYRSVLSS GLAFGARRWV ATLQRYCECM  540
SILMSPTISA EDQTVINISG KKSMLKLARR MVDNFCSGVC ASSVHKWDKL LVGNVGEDMR  600
ILTRKNINDP GEPPGIVLSA ATSVWLPVMR DRLFDFLRDE RSRSEWDILS HGGMMQEMVH  660
ISKGHNRGNC VSLLRSTAVS PNANENSMII LQETWNDASS SLVVYAPVDI QSISVVMNGG  720
DSTYVALLPS GFVILPDDTS SQGGPNFSST LVKRDSDGGD GGGSILTVGF QILVNNLPTA  780
KLTVESVETV NNLISCTIQR IKTVLQLT*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.06G145500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021614580.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A2C9VR060.0A0A2C9VR06_MANES; Uncharacterized protein
STRINGcassava4.1_002279m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]