PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G141600.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MIKC_MADS
Protein Properties Length: 186aa    MW: 21750.2 Da    PI: 7.4189
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G141600.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.58.8e-29959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         k ien + rqvtfskRrng+lKKA+ELSvLCdaev+v+ifs++g+l e+ss
  Manes.06G141600.4.p  9 KMIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVSVLIFSQKGRLSEFSS 59
                         68***********************************************96 PP

2K-box61.34e-2182170997
                K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                           +e+  ++l  e++ + k+ie+L+  qR++lG++L s+sl+eLq++ ++Leksl++iR+kK+ +++eqie+l++ke+ l  en  Lr+k
  Manes.06G141600.4.p  82 DTEQRIQQLISESTEMVKKIEQLEILQRKFLGQELASCSLEELQEMDSKLEKSLSNIRAKKEVMFKEQIEQLKEKERLLLVENAILREK 170
                          5788899999****************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.501161IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-38160IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-29323IPR002100Transcription factor, MADS-box
CDDcd002653.99E-39372No hitNo description
SuperFamilySSF554551.7E-31375IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.3E-241157IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-293859IPR002100Transcription factor, MADS-box
PfamPF014864.9E-2084170IPR002487Transcription factor, K-box
PROSITE profilePS5129713.17487180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MVRGKVQMKM IENATSRQVT FSKRRNGLLK KAYELSVLCD AEVSVLIFSQ KGRLSEFSSN  60
DMQKTIERYR KHVEELQPEN NDTEQRIQQL ISESTEMVKK IEQLEILQRK FLGQELASCS  120
LEELQEMDSK LEKSLSNIRA KKEVMFKEQI EQLKEKERLL LVENAILREK ELHVDQFVNI  180
YLVAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-19181181Myocyte-specific enhancer factor 2B
1tqe_Q5e-19181181Myocyte-specific enhancer factor 2B
1tqe_R5e-19181181Myocyte-specific enhancer factor 2B
1tqe_S5e-19181181Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002510866.13e-81PREDICTED: MADS-box protein SOC1
SwissprotQ9FIS17e-74AGL42_ARATH; MADS-box protein AGL42
TrEMBLB9R9J14e-81B9R9J1_RICCO; Mads box protein, putative
STRINGBra029281.1-P1e-72(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.34e-75AGAMOUS-like 42