PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G141600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MIKC_MADS
Protein Properties Length: 214aa    MW: 24735.5 Da    PI: 6.5552
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G141600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.11.1e-28959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         k ien + rqvtfskRrng+lKKA+ELSvLCdaev+v+ifs++g+l e+ss
  Manes.06G141600.1.p  9 KMIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVSVLIFSQKGRLSEFSS 59
                         68***********************************************96 PP

2K-box62.41.7e-21801737100
                K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                          ++ +e+  ++l  e++ + k+ie+L+  qR++lG++L s+sl+eLq++ ++Leksl++iR+kK+ +++eqie+l++ke+ l  en  Lr+
  Manes.06G141600.1.p  80 NNDTEQRIQQLISESTEMVKKIEQLEILQRKFLGQELASCSLEELQEMDSKLEKSLSNIRAKKEVMFKEQIEQLKEKERLLLVENAILRE 169
                          3367889999******************************************************************************** PP

                K-box  97 klee 100
                          k +e
  Manes.06G141600.1.p 170 KCDE 173
                          9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.501161IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-29323IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-31375IPR002100Transcription factor, MADS-box
CDDcd002654.22E-39372No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.6E-241157IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-293859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-2084171IPR002487Transcription factor, K-box
PROSITE profilePS5129713.46687177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MVRGKVQMKM IENATSRQVT FSKRRNGLLK KAYELSVLCD AEVSVLIFSQ KGRLSEFSSN  60
DMQKTIERYR KHVEELQPEN NDTEQRIQQL ISESTEMVKK IEQLEILQRK FLGQELASCS  120
LEELQEMDSK LEKSLSNIRA KKEVMFKEQI EQLKEKERLL LVENAILREK CDEKACPLPT  180
QQKEVSFSSL SSDISEVETR LSIRLPEPVT HLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-18181181Myocyte-specific enhancer factor 2B
1tqe_Q1e-18181181Myocyte-specific enhancer factor 2B
1tqe_R1e-18181181Myocyte-specific enhancer factor 2B
1tqe_S1e-18181181Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002510866.11e-91PREDICTED: MADS-box protein SOC1
SwissprotQ9FIS15e-75AGL42_ARATH; MADS-box protein AGL42
TrEMBLB9R9J12e-91B9R9J1_RICCO; Mads box protein, putative
STRINGBra029281.1-P7e-76(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66630102
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.33e-76AGAMOUS-like 42