PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G097500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 295aa    MW: 32931.5 Da    PI: 6.0265
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G097500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.45.1e-38101101101
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCaaCk+ rrkC+++C+lapyf  +qpk f+n+hklFG+sn+lk+lk+l+  ++ +am+s++y++++r r Pv+G+ g+i +l+ q++q+
  Manes.06G097500.1.p  10 ACAACKYRRRKCSSECPLAPYFLPDQPKMFQNAHKLFGVSNILKILKNLDAPQKAEAMRSIIYQSNIRDRFPVHGCWGIICQLHYQIRQA 99 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkeel 101
                          ++el++++++l
  Manes.06G097500.1.p 100 EEELHAVHSQL 110
                          *******9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.9159110IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3610107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MTLKGGTSQA CAACKYRRRK CSSECPLAPY FLPDQPKMFQ NAHKLFGVSN ILKILKNLDA  60
PQKAEAMRSI IYQSNIRDRF PVHGCWGIIC QLHYQIRQAE EELHAVHSQL EMYRQHQQHQ  120
ISSLTDDVPS QLELGMATPS NALSLFGHST SPQPYDVVNA LPISQQHSYS NSSNAGYSSG  180
YLDSKDHLGN SSLWVQHPYA TTTNNNNNNT NPMAIQSQLV ASQPLSIQQE VVQDYDEIHP  240
FFDTIDDRQS YIDSKEAYDS SSEESLKDTT QSIEHVAENE LKSAAACFSL TSVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-2761137114LOB family transfactor Ramosa2.1
5ly0_B4e-2761137114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.06G097500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021616263.10.0LOB domain-containing protein 27-like
SwissprotQ9STS62e-62LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A2C9VPJ50.0A0A2C9VPJ5_MANES; Uncharacterized protein
STRINGcassava4.1_033210m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.18e-53LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]