PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G081900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MIKC_MADS
Protein Properties Length: 184aa    MW: 21308.9 Da    PI: 9.7505
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G081900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.92e-31959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krienk+nrqvtf+kRrng+lKKA+ELSvLCdae+a+iifs++gklye++s
  Manes.06G081900.1.p  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSTRGKLYEFCS 59
                         79***********************************************96 PP

2K-box82.11.3e-27861581385
                K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 
                          +++s +qe+ kLk++ e Lqr+qR+llG++L++L+ keL+qLe qLe+slk+iR +K++++l q+ +lq+k +
  Manes.06G081900.1.p  86 ETQSNHQEYLKLKARFEVLQRSQRNLLGDELGPLNTKELEQLELQLETSLKRIRFTKTQFMLHQLADLQNKVH 158
                          68999*****************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.548161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-33288IPR002100Transcription factor, MADS-box
CDDcd002655.31E-44276No hitNo description
PRINTSPR004044.3E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-323859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.3187183IPR002487Transcription factor, K-box
PfamPF014862.0E-2287158IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MGRGKVVLKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEIALIIFST RGKLYEFCST  60
SSMMRTLERY QKCSYGAMEA SYPGYETQSN HQEYLKLKAR FEVLQRSQRN LLGDELGPLN  120
TKELEQLELQ LETSLKRIRF TKTQFMLHQL ADLQNKVHTF FWGSAASFFL LCMQLLEFCV  180
ILG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D8e-2875156186Developmental protein SEPALLATA 3
4ox0_C8e-2875156186Developmental protein SEPALLATA 3
4ox0_B8e-2875156186Developmental protein SEPALLATA 3
4ox0_A8e-2875156186Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN2978602e-58FN297860.1 Gerbera hybrid cultivar mRNA for GRCD4 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002514624.28e-91PREDICTED: MADS-box protein CMB1
SwissprotQ396852e-83CMB1_DIACA; MADS-box protein CMB1
TrEMBLI1LWW11e-90I1LWW1_SOYBN; Uncharacterized protein
TrEMBLQ3Y4G81e-90Q3Y4G8_SOYBN; MADS-box protein
STRINGGLYMA13G06730.15e-89(Glycine max)
STRINGGLYMA19G04320.15e-89(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22932178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.31e-76MIKC_MADS family protein