PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G079700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family bZIP
Protein Properties Length: 203aa    MW: 23085.9 Da    PI: 9.8999
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G079700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.43.7e-14104162563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          +r +r+++NRe+ArrsR RKk++ieeL+  v  L++ N++L +++ +l +   +  +e+
  Manes.06G079700.1.p 104 RRLKRMISNRESARRSRMRKKKQIEELQYQVNHLQTMNHQLSEKVIRLLESNHQILQEN 162
                          689********************************************999999988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.2E-14100164IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.921102165IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.0E-13104160No hitNo description
SuperFamilySSF579598.75E-12104156No hitNo description
PfamPF001706.8E-13104162IPR004827Basic-leucine zipper domain
CDDcd147022.48E-16105156No hitNo description
PROSITE patternPS000360107122IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MESQEIKGLH YLPHANSFQN LLTLSPSVAN LNIQVQPVKS IGHNLTHANL SQNPESNSSF  60
LNRSFSSNSP IHFPLHMLSP HNSAISTDST VNETGDQLGI TYERRLKRMI SNRESARRSR  120
MRKKKQIEEL QYQVNHLQTM NHQLSEKVIR LLESNHQILQ ENSQLKERVS SFQIVLSDLL  180
TPIRNVEESI CNTNRPRGEA SN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.06G079700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021614999.11e-144bZIP transcription factor 11-like
TrEMBLA0A2C9VQA51e-143A0A2C9VQA5_MANES; Uncharacterized protein
STRINGcassava4.1_026149m1e-144(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.11e-41basic leucine-zipper 70