PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G054900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NF-YA
Protein Properties Length: 213aa    MW: 23342.7 Da    PI: 7.7764
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G054900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.76.9e-32117173158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep++VNaKQy++Il+RRq+Rak+e+e+k  +ksrkpylheSRh hAlrR+Rg gGrF
  Manes.06G054900.1.p 117 EEPVFVNAKQYHGILRRRQSRAKAESENKA-IKSRKPYLHESRHLHALRRARGLGGRF 173
                          69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.5E-35115176IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.376116176IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.8E-27118173IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.5E-23119141IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860121141IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.5E-23150173IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MTSSVHDLSD CCPDNSETSE QQKHSEPQVH SSSPATASMH PGMSNPNAQY ATNLQLGSGH  60
AMAAAAYPYP DPYYRSIFAP YDAQPYPPQP YGGQPMVHLQ LMGIQQAGVP LPSDAVEEPV  120
FVNAKQYHGI LRRRQSRAKA ESENKAIKSR KPYLHESRHL HALRRARGLG GRFLNSKKDE  180
NQQENDSVGD KSQSNINLNS DKNDIASSDS KS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-20116186171NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.06G054900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021616929.11e-157nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_021616930.11e-157nuclear transcription factor Y subunit A-7-like isoform X1
SwissprotQ84JP16e-70NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A2C9VPI11e-155A0A2C9VPI1_MANES; Uncharacterized protein
STRINGcassava4.1_016099m1e-156(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53793355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.21e-42nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]