PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G038500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family ARR-B
Protein Properties Length: 699aa    MW: 76898.7 Da    PI: 5.639
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G038500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like919.9e-29208261155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr++W+ eLH++Fv av++L G +kA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Manes.06G038500.1.p 208 KPRVVWSVELHRKFVAAVNHL-GLDKAVPKKILDLMNVEGLTRENVASHLQKYRL 261
                          79*******************.********************************8 PP

2Response_reg85.71.4e-28221301109
                          EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHH CS
         Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedale 88 
                          +l vdD+p+ +++l+++l+k +y +v+++ ++ +al++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah+++e++ +
  Manes.06G038500.1.p  22 ILAVDDDPICLKVLENLLRKCQY-HVTTTNQAIAALKMLRENKnkYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDKELVYK 109
                          799********************.***************888888*******************87754.558***************** PP

                          HHHTTESEEEESS--HHHHHH CS
         Response_reg  89 alkaGakdflsKpfdpeelvk 109
                           +  Ga d+l Kp+ +eel +
  Manes.06G038500.1.p 110 GVTHGAVDYLLKPVRIEELKN 130
                          ******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.4E-1671698IPR017053Response regulator B-type, plant
SuperFamilySSF521727.83E-3719144IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.2E-4319143No hitNo description
SMARTSM004481.6E-3420132IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.11821136IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-2522130IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.84E-2923136No hitNo description
SuperFamilySSF466896.99E-20205265IPR009057Homeodomain-like
PROSITE profilePS5129412.375205264IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-30205266IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-25208261IPR006447Myb domain, plants
PfamPF002492.7E-7210260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
MTVEDKRSGL VNDDCFPVGM RILAVDDDPI CLKVLENLLR KCQYHVTTTN QAIAALKMLR  60
ENKNKYDLVI SDVNMPDMDG FKLLELVGLE MDLPVIMLSA HSDKELVYKG VTHGAVDYLL  120
KPVRIEELKN IWQHVIRRKK TQPGDQNRSP NQGKPLDEAQ EGGQGLASSG SVDQNGKVNR  180
KRKDQDEDEE EEGEENLNEN EDPGTQKKPR VVWSVELHRK FVAAVNHLGL DKAVPKKILD  240
LMNVEGLTRE NVASHLQKYR LYLKRISSVA SQQANMVAAF GAKDSSYLRM GSLDGFGDFR  300
TSNGPGRPSS TSISSYTTGG MFGRLNSPAG LTLRGIASSG LLQSGHSQSP SNSVITLGKF  360
QPAVLPASPG ANLFQGVQSS VEPNQLKVKS NAHIGQFTRN DDTSGFTLAT NFVDARVTIG  420
GLSNTVSNST SNPLMLQVNP QLSQYRGAFA TQSSLSVPTL NHESFDVRLH GSSNFLDHSR  480
CTENWQGAVQ LSKFPTNSLP LSEPFSHDSL SRSNLRDNLP STSSQIGNSL NDFDSSSVHA  540
TPLYSRVDMQ GQTGSISNVV QNMNYNSRQR WEEYSRDYNP NLNNSFSTIN SLVSGNGVVG  600
LLSQSMDQRN KFDASLPGQI NNVTPSTFLH AEVDNSALDP KMRSNEDYLL EQTKSQNGFA  660
QNNYDPLDDI MDAMIKQEQQ NEAMLMDGEF GFDDAYSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-26206267364ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.06G038500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021614732.10.0two-component response regulator ARR18-like isoform X2
TrEMBLA0A2C9VMN00.0A0A2C9VMN0_MANES; Uncharacterized protein
STRINGcassava4.1_002738m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-122response regulator 12