PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G001800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family G2-like
Protein Properties Length: 406aa    MW: 44728.8 Da    PI: 7.6304
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G001800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.5e-32232285255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Manes.06G001800.1.p 232 PRMRWTSSLHSRFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 285
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15229286IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28230286IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-24232285IPR006447Myb domain, plants
PfamPF002496.1E-7233284IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MSHKGGIFHS QSLNQIPDLS LHISLPNRTP SSICTATNDD ADDSTFDVWS KDDSLKPHKD  60
SSIKVGSLPD ETIDLTLAAN PAATIALQVE SPWRRISYAG GGGGSQADQR NNVLLQRSNG  120
GSMSQLDRGI SGFKPIKGFP VYSCWNINSG EMDPRFCFNQ IPYPSSCTPY SSPGDTCSSF  180
PAYRMAAPSV RPQFQYHQYG GGVVGGAEVY GGGMIRSRFT PKLQNKRNMR APRMRWTSSL  240
HSRFVHAVEL LGGHERATPK SVLELMDVKD LTLAHVKSHL QMYRTVKSTD KPAASSDGSA  300
DEDFLSVTTP INQISNHKTS SCVSLQHDDG YTTSSTPWIN SSRERWVQSS SRDMEGLRPP  360
QNQLSHQAFE ESEIRSFRSV CNQLLETPSL EFSLGRPDWQ SKLHD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-17233287357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-17233287357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-17233287357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-17233287357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.06G001800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021615100.10.0transcription repressor KAN1-like isoform X4
TrEMBLA0A2C9VLG30.0A0A2C9VLG3_MANES; Uncharacterized protein
STRINGcassava4.1_011084m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-59G2-like family protein