PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G188800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 167aa    MW: 18502.2 Da    PI: 8.2146
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G188800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.51.1e-4361051100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +Ca+C++lrr+C+kdCv+apyfp+++p kfa+vhk+FGasnv+k+l+a+p ++reda++slvyeA+ar++dPvyG+vg i+ lq+q++ql
  Manes.05G188800.1.p   6 PCASCRLLRRRCTKDCVFAPYFPSNEPCKFAIVHKVFGASNVSKMLQAIPAHQREDAARSLVYEANARVKDPVYGCVGAISILQNQVSQL 95 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + +l+++++e
  Manes.05G188800.1.p  96 QMQLSEARAE 105
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7195106IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-436103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MVGSSPCASC RLLRRRCTKD CVFAPYFPSN EPCKFAIVHK VFGASNVSKM LQAIPAHQRE  60
DAARSLVYEA NARVKDPVYG CVGAISILQN QVSQLQMQLS EARAEILCIQ MLEKPTIPNH  120
LNHDVKSSSV YPATNFNTFP QSHCFNFESP SNVIIQDPLK SESLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298499.13e-83LOB domain protein 12
SwissprotQ8LBW31e-69LBD12_ARATH; LOB domain-containing protein 12
TrEMBLB9GH623e-83B9GH62_POPTR; LOB domain protein 12
STRINGPOPTR_0001s28840.19e-83(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-71LBD family protein