PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G184900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 369aa    MW: 42143.2 Da    PI: 6.7988
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G184900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33e-092953302055
                          HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Manes.05G184900.1.p 295 YKWPYPSETEKVALAESTGLDQKQINNWFINQRKRH 330
                          4679*****************************885 PP

2ELK37.93.8e-13250271122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ELK++LlrKYsgyL+sLkqE+s
  Manes.05G184900.1.p 250 ELKNHLLRKYSGYLSSLKQELS 271
                          9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.5E-21106150IPR005540KNOX1
PfamPF037908.1E-22107148IPR005540KNOX1
SMARTSM012561.9E-31157208IPR005541KNOX2
PfamPF037916.1E-26162207IPR005541KNOX2
PROSITE profilePS5121311.296250270IPR005539ELK domain
SMARTSM011883.5E-7250271IPR005539ELK domain
PfamPF037892.6E-10250271IPR005539ELK domain
PROSITE profilePS5007113.038270333IPR001356Homeobox domain
SuperFamilySSF466895.99E-20271345IPR009057Homeodomain-like
SMARTSM003896.6E-13272337IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-27275336IPR009057Homeodomain-like
CDDcd000866.99E-12282334No hitNo description
PfamPF059201.4E-16290329IPR008422Homeobox KN domain
PROSITE patternPS000270308331IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MEGYNHINDN TNPRGNFLYA SALLAPNSSP YGRTNSGSNV SNQQTQMPLS PFHLQSSECF  60
QSEAHPIVKT EASTSHHVQK FHYPLLRGHH QALNQHQGNE SSSDVEAIKA KIIAHPQYFK  120
LLEAYMDCQK VGAPPEVVAR LAAARQDFEA KQRSSVTSRD ASKDPELDQF MEAYCDMLVK  180
YREELTRPIQ EAMDFMRRIE TQLNTICNGP LRIFNSDEKS EGVGSSEEDQ ENSGGETELP  240
EIDPRAEDRE LKNHLLRKYS GYLSSLKQEL SKKKKKGKLP KEARQKLLNW WELHYKWPYP  300
SETEKVALAE STGLDQKQIN NWFINQRKRH WKPSEDMQFM VMDGLHPQSA ALYMDGHYMG  360
DGPYRLGP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012068139.10.0PREDICTED: homeobox protein knotted-1-like 2
SwissprotO041351e-180KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLA0A067KZF30.0A0A067KZF3_JATCU; Uncharacterized protein
STRINGVIT_18s0001g08380.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45843246
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-152KNOTTED-like from Arabidopsis thaliana