PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G153200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SRS
Protein Properties Length: 303aa    MW: 33398.8 Da    PI: 6.4974
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G153200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702230.72.5e-71892394153
               DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa....aeaaskrkrelkskkqsalsst 89 
                          g+++CqdCGnqakkdC+h+RCRtCCksrgf C+thvkstWvpa+krrerqqql+++++++++++    + +++kr+re+ +  + +l++t
  Manes.05G153200.1.p  89 GGMNCQDCGNQAKKDCVHMRCRTCCKSRGFPCQTHVKSTWVPASKRRERQQQLSSLQEQQQQQQqqqfRGENPKRQREN-QGDAPSLACT 177
                          789****************************************************998888777444444455555544.4445555666 PP

               DUF702  90 klssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                          +l  a++++ le++++P+ev+s+avfrcvrvs +d+ +e++aYqtav+igGhvfkGiLydqG++
  Manes.05G153200.1.p 178 RL--ATTTTGLEIEHFPPEVNSPAVFRCVRVSPMDEPDEQYAYQTAVNIGGHVFKGILYDQGPD 239
                          65..555677999*************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051426.4E-6990239IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.0E-2792134IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016246.1E-26190238IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MAGWFYLSGR EGASSKVQEE NKDPENNFFL YRSNEEIDNK GFEIWQQDYQ QQQNMNSYSS  60
YGVGLSRISL SDESSRSGFM VMRQSGVGGG MNCQDCGNQA KKDCVHMRCR TCCKSRGFPC  120
QTHVKSTWVP ASKRRERQQQ LSSLQEQQQQ QQQQQFRGEN PKRQRENQGD APSLACTRLA  180
TTTTGLEIEH FPPEVNSPAV FRCVRVSPMD EPDEQYAYQT AVNIGGHVFK GILYDQGPDG  240
RYTSGGESSS GGGQQLNFMT AATTSAAATT TNANNPGAGA LLDPSLYPAP FNAFIAVLTC  300
NQ*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:16740146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.05G153200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0119661e-124AP011966.1 Jatropha curcas DNA, clone: JHL18I08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021612339.10.0protein SHI RELATED SEQUENCE 5-like isoform X2
SwissprotQ9LQZ51e-83SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLA0A2C9VWI90.0A0A2C9VWI9_MANES; Uncharacterized protein
STRINGcassava4.1_021201m1e-179(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.21e-65SHI-related sequence 7
Publications ? help Back to Top
  1. Estornell LH,Landberg K,Cierlik I,Sundberg E
    SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 150
    [PMID:29491878]