PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G130100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 1075aa    MW: 118754 Da    PI: 8.4052
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G130100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.2e-40148225178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqv++C++dls+ak+yhrrhkvC vhsk++++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Manes.05G130100.1.p 148 MCQVDNCKEDLSNAKDYHRRHKVCGVHSKSAKALVGEQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 225
                          6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-33143210IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.479146223IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.92E-37147227IPR004333Transcription factor, SBP-box
PfamPF031103.2E-29149222IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1075 aa     Download sequence    Send to blast
MEELGAQVAP PIFIHQALSS RFCDAPSMAK KRDLSYQTTN FQLQQQHRFV QNPRDNWNPK  60
SWNWDSVRFV AKTSDGDANI LQLGSASAEL KKKTEASGGH LPLKKAAVDE DDGLRLNLAG  120
GLNSVEEPVS RPNKRVRSGS PGTATYPMCQ VDNCKEDLSN AKDYHRRHKV CGVHSKSAKA  180
LVGEQMQRFC QQCSRFHPLS EFDEGKRSCR RRLAGHNRRR RKTQPDDVTS RLLLPGNRDS  240
TGNANLDIVN LLTALARTQG KNEGKIINNA QVPDRDQLIQ ILSKINSLPL PMDLAAKLSN  300
IKNLNSKNPD QPSADLQNRL LGNTSSQSTM DLLAVLSATL TASGPDALAF LSQRSSQSSD  360
SEKSKLTSPD QATGPNLQKR PIIEFPSVGG ERSSSCYRSP VEDSDYQLQE SCPNLPLQLF  420
SSSPEDNSPP KLASSRKYFS SDSSNPSEGR SSSSSPPVVQ RLFPLQSMAE TVKSEKMSMS  480
REVNANTEGS RTHGCALPLE LFRDSNGGAD QSSFQTFPYQ AGYTSSSGSD HSPSSQNSDA  540
QDRSGRIIFK LFDKDPSHLP GKLRTQIYNW LSNSPSEMES YIRPGCVVLT VYLSMSSAAW  600
EQLERNLLQQ VYSLIQDSES DLWRTGRFLL HTSRQLASHK DGNVRLCKSW RTWSSPELIS  660
VSPLAVVGGQ ETSLMLRGRN LTNPGTKIHC TYMGGYTSKE VIGSTSPGAM YDEINVNGFK  720
FDGASPSVLG RCFIEVENGF KGNSFPLIIA DATICKELRL LESEFDDETK DTDIIAEEQA  780
QCLDQPRSRE KVLHFLNELG WLFQRRKVSS MFELPEYSLS RFKFLLIFSV ERDYCALVKT  840
ILDMLVERNL HASAVSKESL EMLSEIQLVN RAVKRRCRKM VDLLIHYSIN GSDISSKKYI  900
FPPSLAGPGG ITSLHLAACT SGSDELVDAL TNDPQEIGLS CWSSLLDANN QSPYAYALMT  960
NNHSYNTLVA RKLADRRNGQ VTVVVGNEMG QPSSSRTTSN FQQGRSRSCA KCASVAAKYN  1020
RRVMGSQGLL QRPYVHSMLA IAAVCVCVCL FLRGAPDIGL VAPFKWETLD YGTI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-30139222184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1870875RAVKRR
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.05G130100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3535541e-32AK353554.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-52-I08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021613810.10.0squamosa promoter-binding-like protein 14 isoform X1
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2C9VVS10.0A0A2C9VVS1_MANES; Uncharacterized protein
STRINGcassava4.1_000685m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]