PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G112200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 350aa    MW: 38928.2 Da    PI: 8.8721
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G112200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1352.4e-42108184177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +Cqv gC++dls++k+y++rhkvCevhsk+p+v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Manes.05G112200.1.p 108 ICQVYGCHKDLSSLKDYNKRHKVCEVHSKTPKVIVNGVEQRFCQQCSRFHLLVEFDDGKRSCRKRLAGHNERRRKPQ 184
                          5**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.1E-34102170IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.206106183IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.27E-39107187IPR004333Transcription factor, SBP-box
PfamPF031105.6E-32109182IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MESLRYSAEG KGLVFSDEID LSIDSFGRSR KSFTRWDGDS VENMEFIDLG FSEMPIKPFN  60
GNNTGRLADG KEAPNSKFLK ERSVVSSTSP NFQAKKTRTM SSRSQTPICQ VYGCHKDLSS  120
LKDYNKRHKV CEVHSKTPKV IVNGVEQRFC QQCSRFHLLV EFDDGKRSCR KRLAGHNERR  180
RKPQFGALSG TKYLGTSMPK RASFLFPNIL PGGILYPERY EETNCCRPVK LEDISINSTN  240
GQLVPNSFLH LHTNGIQNTT GISLSAIEEL TVYNTVSDIH ELSRVSNSSC ALSLLSAESQ  300
NLGHSAGIIM AMPFISQARG ISDKTFGVES SDGCLRIFIE WSNKGILCK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281081821084squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.05G112200.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021614239.10.0squamosa promoter-binding-like protein 6
SwissprotQ94JW89e-51SPL6_ARATH; Squamosa promoter-binding-like protein 6
TrEMBLA0A251KVD50.0A0A251KVD5_MANES; Uncharacterized protein
STRINGcassava4.1_006155m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-50SBP family protein
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]