PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G065900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family HB-other
Protein Properties Length: 1056aa    MW: 116493 Da    PI: 9.2274
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G065900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.44.3e-0769125157
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                          +r+R  ++++ ++ ++++F  +  +s++e +e++++ g+t +qV+ +F  +R + +k
  Manes.05G065900.1.p  69 KRPRDLLNPKAIKYMQAVFSLKDAISKKESREISAQFGVTVTQVRDFFASQRSRVRK 125
                          799**************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.17166126IPR001356Homeobox domain
SMARTSM003893.0E-468130IPR001356Homeobox domain
PfamPF000461.4E-469125IPR001356Homeobox domain
SuperFamilySSF466892.22E-669129IPR009057Homeodomain-like
CDDcd000861.09E-469125No hitNo description
Gene3DG3DSA:1.10.10.604.0E-669130IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.101.8E-6246339IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476764.18E-6247338IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1056 aa     Download sequence    Send to blast
MEALKENLEE IEIGSSVESF HKFLDSQKEL FHSQIDQLQR IVVNQCKLTG VNPLSQEMAA  60
GAMSIKIGKR PRDLLNPKAI KYMQAVFSLK DAISKKESRE ISAQFGVTVT QVRDFFASQR  120
SRVRKLVRLS REKVARTTVR EQPQDEVPAS SDPMMPINLA PLNSVHPDPD PVPLNFAGPN  180
GGPVSSVGPS SVEESPSCST QDDILPGLND LDKNFVENIF ILLRKEETFS GQEKLMEWIL  240
QIQNPSVLNW FLTKGGVMIL ATWLSQAAAE EQTSILLVAL KVLCHLPLHK ALPEHMSAIL  300
HSVNRLRFYR TSDISNRARV LLSRWSKIFA RSQAMKKPSG VKSSVDAQEM ILKQSIDEIM  360
GNELWQPNVG NPEDGVTTPG TLENTRKVEP SQTLKLLPSS TDDSSKKHVL GVSFTRERRK  420
VQLVEQPGQK TASKSPQATK AVSISQSRPM STDDIQKAKM RALFMQGKYG KTGSSSIGTN  480
IMKTESSSKP SNTQSSNLFP VSKAPLQPKT VEHEKPLIVL SKISDKREGS LDPKHKMDSK  540
EPMGEVCRRI QIPWKTPSEI KLNSLWRVGT GENSKEVDVQ KNRNRREIET VYRTVLDIPS  600
NPKEPWDLEM DYDDTLTPDI PVEQPADADA DADADAAETQ VSHNENIVEN TVVAPALSLT  660
QNEGGSAAEP DLELLAVLLK NPELVFALTN AQGGNLSAEE TVKLLDMIKK SGAGLANSLS  720
GFGGEVREKF EVSLPSPTPS SNPGTSGWRP EDAKNPFSQQ GSRRNRVAYT DPVVSTHNSS  780
VDKLTGLVQP QNQASSTRMP QQQASLQMLP QQVQGAMPPF SWPQTTSSTS ENRQPSLVLP  840
SHQSFPSKST VLQTQSSEMG LATKNLPFSS HSLNNFSATA GTSMRIETVN NVKPVPSVSF  900
PMNAPDRRQD SFPMPIATPT PTRPHSLVSE PAVVQASTGN LVSVPDSWRA RQRLASTSAS  960
QVNQTNNDGM FRGSVQPQVR SGPPWERNEY KGDEGFESWS PENSPGRSPE YMQGRNHTGS  1020
GRINTGWKYT PDNGSRQQNH SGRWDHYRNG NRRWR*
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.05G065900.1.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021611620.10.0homeobox protein LUMINIDEPENDENS
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A2C9VWC30.0A0A2C9VWC3_MANES; Uncharacterized protein
STRINGcassava4.1_000740m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]