PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G041900.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MIKC_MADS
Protein Properties Length: 216aa    MW: 24981.8 Da    PI: 9.5017
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G041900.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.74e-301058250
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         rien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye++
  Manes.05G041900.5.p 10 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFA 58
                         8***********************************************8 PP

2K-box80.93e-2779171698
                K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                          +k+++e+++  l++e++++ k+ie L+  +R+llGe+L+ ++++eLqq+eqqLe+s+++iR++Kn++++eqie+l++kek+l++en +L+
  Manes.05G041900.5.p  79 NKQTSEEDMLLLKTEATNMVKKIELLEIAKRKLLGEGLGACTIEELQQIEQQLERSVSNIRARKNQVFKEQIERLKEKEKQLEDENAKLS 168
                          445788888999*****************************************************************************9 PP

                K-box  96 kkl 98 
                          +k 
  Manes.05G041900.5.p 169 EKC 171
                          986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.595161IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-30323IPR002100Transcription factor, MADS-box
CDDcd002651.47E-41372No hitNo description
SuperFamilySSF554553.14E-33387IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.1E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.6E-2683171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.22587177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MVRGKTQMRR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP RGKLYEFANS  60
SMQETIERYR RHVKDTKINK QTSEEDMLLL KTEATNMVKK IELLEIAKRK LLGEGLGACT  120
IEELQQIEQQ LERSVSNIRA RKNQVFKEQI ERLKEKEKQL EDENAKLSEK CGAHKWQGLK  180
MVEESRACEE RSPVSDVETE LFIGPPETRT QRLLQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D7e-19372271Myocyte-specific enhancer factor 2A
3mu6_C7e-19372271Myocyte-specific enhancer factor 2A
3mu6_B7e-19372271Myocyte-specific enhancer factor 2A
3mu6_A7e-19372271Myocyte-specific enhancer factor 2A
1egw_D1e-18372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-18372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-18372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-18372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J1e-18372271Myocyte-specific enhancer factor 2A
3p57_I1e-18372271Myocyte-specific enhancer factor 2A
3p57_D1e-18372271Myocyte-specific enhancer factor 2A
3p57_C1e-18372271Myocyte-specific enhancer factor 2A
3p57_B1e-18372271Myocyte-specific enhancer factor 2A
3p57_A1e-18372271Myocyte-specific enhancer factor 2A
3kov_J1e-18372271Myocyte-specific enhancer factor 2A
3kov_I1e-18372271Myocyte-specific enhancer factor 2A
3kov_B1e-18372271Myocyte-specific enhancer factor 2A
3kov_A1e-18372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU1429140.0GU142914.1 Hevea brasiliensis MADS-box transcription factor 2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511767.21e-118PREDICTED: MADS-box protein SOC1 isoform X1
RefseqXP_015584388.11e-118PREDICTED: MADS-box protein SOC1 isoform X1
RefseqXP_015584389.11e-118PREDICTED: MADS-box protein SOC1 isoform X1
SwissprotO646457e-94SOC1_ARATH; MADS-box protein SOC1
TrEMBLD1MFS71e-126D1MFS7_HEVBR; MADS-box transcription factor 2
STRINGGLYMA18G45780.11e-99(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-84AGAMOUS-like 20