PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G039400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family HD-ZIP
Protein Properties Length: 823aa    MW: 89065.2 Da    PI: 6.0325
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G039400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.6e-21116171156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Manes.05G039400.1.p 116 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 171
                          688999***********************************************999 PP

2START210.85.1e-663265501206
                          HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          ela++a++elvk+a+ +ep+W +s     e++n +e++++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++    
  Manes.05G039400.1.p 326 ELALAAMDELVKMAQTDEPLWIRSLeggrEILNHEEYMRTFTPCIGmkpggFVSEASRETGMVIINSLALVETLMDSN-RWAEMFPcmia 414
                          5899**************************************999899******************************.*********** PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          + +t++vis+g      g lqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +  + +v +++lpSg+++++++ng
  Manes.05G039400.1.p 415 RTSTTDVISNGmggtrnGSLQLMLAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGAPAFVNCRRLPSGCVVQDMPNG 504
                          *****************************************************************999********************** PP

                          EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +skvtwveh+++++ ++h+l+r+l++sg+ +ga++wvatlqrqce+
  Manes.05G039400.1.p 505 YSKVTWVEHAEYDETQIHQLYRPLISSGMGFGAQRWVATLQRQCEC 550
                          ********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.07E-2099173IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-22103173IPR009057Homeodomain-like
PROSITE profilePS5007117.216113173IPR001356Homeobox domain
SMARTSM003899.9E-18114177IPR001356Homeobox domain
CDDcd000861.33E-18115173No hitNo description
PfamPF000461.4E-18116171IPR001356Homeobox domain
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PROSITE profilePS5084844.819317553IPR002913START domain
SuperFamilySSF559616.87E-34319550No hitNo description
CDDcd088751.00E-127321549No hitNo description
PfamPF018521.4E-57326550IPR002913START domain
SMARTSM002343.7E-51326550IPR002913START domain
SuperFamilySSF559612.35E-23578748No hitNo description
SuperFamilySSF559612.35E-23775815No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 823 aa     Download sequence    Send to blast
MSFGGFLENG SPGGGGARIV ADIPYSSSNM PTGAIAQPRL ISPSLTKAMF NSPGLSLALQ  60
QPNIDGQGDI ARMAENFESN GGRRSREEEH ESRSGSDNMD GASGDDQDAA DNPPRKKRYH  120
RHTPQQIQEL EALFKECPHP DEKQRLELSK RLCLETRQVK FWFQNRRTQM KTQLERHENS  180
LLRQENDKLR AENMSIRDAM RNPICSNCGG PAIIGDISLE EQHLRIENAR LKDELDRVCA  240
LAGKFLGRPI SSLAGSIGPP MPNSSLELGV GTNGFSGLST VPATLPLGPD FAGGISGALP  300
VMTQTRPATA GVTGLDRSFE RSMFLELALA AMDELVKMAQ TDEPLWIRSL EGGREILNHE  360
EYMRTFTPCI GMKPGGFVSE ASRETGMVII NSLALVETLM DSNRWAEMFP CMIARTSTTD  420
VISNGMGGTR NGSLQLMLAE LQVLSPLVPV REVNFLRFCK QHAEGVWAVV DVSIDTIRET  480
SGAPAFVNCR RLPSGCVVQD MPNGYSKVTW VEHAEYDETQ IHQLYRPLIS SGMGFGAQRW  540
VATLQRQCEC LAILMSSAVP TRDHTAITAS GRRSMLKLAQ RMTDNFCAGV CASTVHKWNK  600
LNAGNVDEDV RVMTRKSVDD PGEPPGIVLS AATSVWLPVS PQRLFDFLRD ERLRSEWDIL  660
SNGGPMQEMA HIAKGQDHGN CVSLLRASAM NANQSSMLIL QETCIDAAGS LVVYAPVDIP  720
AMHVVMNGGD SAYVALLPSG FAIVPDGPGS RGSLSTPNGP TGNNGGGTGG QQRVSGSLLT  780
VAFQILVNSL PTAKLTVESV ETVNNLISCT VQKIKAALQC ES*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.05G039400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021612685.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A2C9VVI40.0A0A2C9VVI4_MANES; Uncharacterized protein
STRINGcassava4.1_001764m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]