PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G030200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB_related
Protein Properties Length: 363aa    MW: 39584.5 Da    PI: 9.5451
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G030200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.21.8e-1382126147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Manes.05G030200.1.p  82 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 126
                          789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-1676132IPR009057Homeodomain-like
PROSITE profilePS5129415.40877131IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-680132IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-1880129IPR006447Myb domain, plants
SMARTSM007175.3E-1181129IPR001005SANT/Myb domain
PfamPF002493.1E-1182126IPR001005SANT/Myb domain
CDDcd001672.48E-884127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MVSVNPNPVQ GFYFFDPMGM GLPGLNSLPP QTTSTTATTA TTTNTTAVNT SASTTSSAAN  60
TLAFADDPSK KIRKPYTITK SRESWTEQEH DKFLEALQLF DRDWKKIEAF VGSKTVIQIR  120
SHAQKYFLKV QKNGTSEHVP PPRPKRKAAH PYPQKAAKNA LAVSQVAGPF QSSSASLEPG  180
YVHRQDSSSV LGNPMTGGTL TTWNFNPVAP VNVSQVTKDD VGLAGPPTAH NCCYSSSNES  240
TPRTWQTSEI IDRGDQGKPM RVMPDFALVY SFIGSVFDPN ASGQLQRLKQ MDPINLETAL  300
LLMRNLAINL TSPDFEDHRR LLASYDVNTD NAKSGGPYSN IVADKTRYPF SSKRSETLKS  360
AC*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.05G030200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU9477696e-91KU947769.1 Toxicodendron vernicifluum microsatellite c26331 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021613697.10.0protein REVEILLE 6-like
SwissprotQ8H0W31e-111RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A2C9VSV30.0A0A2C9VSV3_MANES; Uncharacterized protein
STRINGcassava4.1_010350m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.28e-96MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]