PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G015600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB_related
Protein Properties Length: 743aa    MW: 81386.5 Da    PI: 7.2181
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G015600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.5e-162468147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                         r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Manes.05G015600.1.p 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.98E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.0911973IPR017930Myb domain
TIGRFAMsTIGR015578.1E-172271IPR006447Myb domain, plants
SMARTSM007177.3E-132371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-82464IPR009057Homeodomain-like
PfamPF002493.1E-132467IPR001005SANT/Myb domain
CDDcd001671.42E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MDTYSSGEDL VIKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEAVAKG VPIGQALDID IPPPRPKRKP HNPYPRKTGV GPPPSHVAVK  120
DGNPLNCKQT LDLEKEPPPE KSSGDEKHAN GKENQDNSRS EVFTVVQEAH CPSVPSANKN  180
SVPMPEALRK SCSVREFVPS LKEVVNQDAS NESYITIELH GNQKLDKPDA KQTVQDNGTN  240
KGAKLASCPF HEKFVQGKKS NEFNNALPTD EMEAVQNYPR HVPVHVLDGS LGTCTHTPPS  300
DVSFQDSIFQ PIGEVHGHPN LYSYPAASTT TQNQTYPPSL APTHHNQDDY RSFLHISSAF  360
SSLIVSTLLQ NPAAHAAASF AATFWPYANM ASSADSPPCA QGGFPSRQMN SAPSMAAIAA  420
ATVAAATAWW AAHGLLPLCA PLHAAFTCSP AATAVPSVDA GQVPAARTER KETTLRNPHL  480
QDQQLDLERS EALQAQNSAS KSPNVSLSDS DESGGPKQNT VSKSTDHEMA ATAPDIHDPS  540
KMKNRKQVDR SSCGSNTSSS SEVETDAPKK LEKDKEESKE VDPNHLANES SSRRSRCSSN  600
TSDSWKEVSE EGRLAFQALF SREILPQSFS PPHDLKGEAH RKDIVEDKQN TDEKDGNASP  660
VNITSMIRES CTSHHELEKK YSGENGLLTI GLGHGKLKAR RTGFKPYKRC SMEAKENRVM  720
TTGCQYEEKG PKRIRVDGEA LI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.05G015600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021612167.10.0protein LHY-like isoform X1
RefseqXP_021612168.10.0protein LHY-like isoform X1
RefseqXP_021612169.10.0protein LHY-like isoform X1
RefseqXP_021612170.10.0protein LHY-like isoform X1
TrEMBLA0A2C9VTV80.0A0A2C9VTV8_MANES; Uncharacterized protein
STRINGcassava4.1_004760m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-115MYB_related family protein