PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.04G145200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family GRAS
Protein Properties Length: 550aa    MW: 61593.5 Da    PI: 6.1759
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.04G145200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS265.32.1e-811645412374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL  cA a++ g+l+++q+lL  l+elas++gd+++Rla+y ++AL+++l++  s++++++ p + ++++ +    +l  f+evsP++
  Manes.04G145200.1.p 164 EHLLNPCAAAITIGNLSRVQHLLYVLHELASSTGDANHRLAFYGLRALNHHLSS--STTSASIGPISFASTEPKFFQRSLIKFYEVSPWF 251
                          699**************************************************9..77777787777776666666667667******** PP

                 GRAS  92 kfshltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleetgerLak 167
                           f + +aN+ Il+ +++e    + +Hi+D+++s+G+QWp+Ll+aL+ R+ ++pp +RiT+v +  ++               +   rL +
  Manes.04G145200.1.p 252 AFPNNIANSSILQILAQEldhkRNLHILDIGVSHGVQWPTLLEALSRRQgGPPPLVRITVVTATVENdqntetpfsVGPPGDNFSTRLLS 341
                          **************99999887899************************55666******9986665666677766666778999***** PP

                 GRAS 168 fAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..ns.esFl 254
                          fA+ +++++++n l  + l++l+ + ++++p+E+l+V+ +++lh+l    +++++er+e+L+++++l+Pk v+++e+++d+  ns ++F+
  Manes.04G145200.1.p 342 FAKCMNINLQINRLDNHPLQNLNGQVMNTDPEETLIVCAQFRLHHLN---HNTPDERTEFLRILRGLQPKGVILSENNTDCscNScGDFA 428
                          *************9999*****************************8...77777889*******************96664354259** PP

                 GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                          ++f++ ++y ++++ds+++ +    + r + Er+l++ e+ ++++++g++    +e +ekW er++++GF +  ++e+a +  ++llrk+
  Manes.04G145200.1.p 429 TGFSRRVDYLWKFLDSTSSAF----KGRESEERRLMEGEAAKALTNRGEM----NEGKEKWCERMRRVGFVSEVFGEDAIDGGRALLRKY 510
                          *****************8886....78888888889999******99999....9*********************************** PP

                 GRAS 345 k.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          + ++++r+ee +g++ l Wk+ p+ ++S W+
  Manes.04G145200.1.p 511 DsNWEMRIEETDGCIGLRWKGLPVSFCSLWK 541
                          *9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.376137520IPR005202Transcription factor GRAS
PfamPF035147.2E-79164541IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MTLEEPEPNH ISDHILDWLE DSASFLPSFL DDPYSSSDIY SYQWWNQTEE ICQDPINNNA  60
SLSSSTSTAV NADSTSLIEA SNPTTSNHQQ LSNLSRKREA ADDPLPQTSH HHQRKKQNHR  120
ISNEDQDGEQ AVEVVAGKKS NGNKKINSKN AGNNGNNREG RWAEHLLNPC AAAITIGNLS  180
RVQHLLYVLH ELASSTGDAN HRLAFYGLRA LNHHLSSSTT SASIGPISFA STEPKFFQRS  240
LIKFYEVSPW FAFPNNIANS SILQILAQEL DHKRNLHILD IGVSHGVQWP TLLEALSRRQ  300
GGPPPLVRIT VVTATVENDQ NTETPFSVGP PGDNFSTRLL SFAKCMNINL QINRLDNHPL  360
QNLNGQVMNT DPEETLIVCA QFRLHHLNHN TPDERTEFLR ILRGLQPKGV ILSENNTDCS  420
CNSCGDFATG FSRRVDYLWK FLDSTSSAFK GRESEERRLM EGEAAKALTN RGEMNEGKEK  480
WCERMRRVGF VSEVFGEDAI DGGRALLRKY DSNWEMRIEE TDGCIGLRWK GLPVSFCSLW  540
KLDLKGNDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B4e-3716054184473Protein SHORT-ROOT
5b3h_B2e-3716054130419Protein SHORT-ROOT
5b3h_E2e-3716054130419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.04G145200.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021610640.10.0nodulation-signaling pathway 1 protein-like
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A2C9W2L40.0A0A2C9W2L4_MANES; Uncharacterized protein
STRINGcassava4.1_033587m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-177GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]