PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.04G033600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WOX
Protein Properties Length: 247aa    MW: 27741.9 Da    PI: 7.4438
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.04G033600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox651e-201978357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         +R+++tkeq++ Le+l+++  r+psa+++++++++l    +++ ++V++WFqN++a++++
  Manes.04G033600.1.p 19 SRWNPTKEQINLLESLYKQgIRTPSADQIQQITARLkdfgHIEGKNVFYWFQNHKARQRQ 78
                         7*****************99**************************************97 PP

2Wus_type_Homeobox115.23.2e-371780265
    Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         +++RW+Pt+eQi++Le+lyk+G+rtP++++iq+ita+L+ +G+ie+kNVfyWFQN+kaR+rqkq
  Manes.04G033600.1.p 17 VNSRWNPTKEQINLLESLYKQGIRTPSADQIQQITARLKDFGHIEGKNVFYWFQNHKARQRQKQ 80
                         689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.27E-141087IPR009057Homeodomain-like
PROSITE profilePS5007111.0131479IPR001356Homeobox domain
SMARTSM003893.7E-41683IPR001356Homeobox domain
PfamPF000462.1E-181978IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-81978IPR009057Homeodomain-like
CDDcd000864.06E-62080No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MQTENIDMGG GPGGGQVNSR WNPTKEQINL LESLYKQGIR TPSADQIQQI TARLKDFGHI  60
EGKNVFYWFQ NHKARQRQKQ KQESLAYFNR YLYKPQQQQQ LVFPRPSTNG VVCGSYYIPQ  120
SDVGFYPQYS TVLLPAGSFK RKPRSEKADK ARAYVSTDRK QQEAMNGNCN ETYQETLPLF  180
PLHPTGILQG REESFCSHGS IISAEDSIAI AAPSSFSENN TVGIELCSSD KPFFDFFSGQ  240
DALESD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.04G033600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021611167.10.0WUSCHEL-related homeobox 2-like
TrEMBLA0A2C9VZ310.0A0A2C9VZ31_MANES; Uncharacterized protein
STRINGcassava4.1_023410m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.15e-52WUSCHEL related homeobox 2