PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.04G025300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 191aa    MW: 20672.4 Da    PI: 5.6445
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.04G025300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.74.1e-43321311100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l
  Manes.04G025300.1.p  32 PCAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCAGAICHLQKQVNEL 121
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+la++++e
  Manes.04G025300.1.p 122 QAQLAKAQAE 131
                          ******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.31331132IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-4332129IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MDHSEAANSN SSSPSSSSSP PTTPPPTVVM SPCAACKILR RRCAEKCVLA PYFPPTEPAK  60
FTIAHRVFGA SNIIKFLQEL PESQRADAVS SMVYEASARI RDPVYGCAGA ICHLQKQVNE  120
LQAQLAKAQA ELVNMQCQQA NLVALLCMSP QQLSGQSVDD FISTPQSYQS NPCFFDDTNC  180
LGSQWEPLWT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-44211393118LOB family transfactor Ramosa2.1
5ly0_B3e-44211393118LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.04G025300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021609899.11e-139LOB domain-containing protein 1-like
SwissprotQ9LQR06e-77LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A2C9W1E61e-138A0A2C9W1E6_MANES; Uncharacterized protein
STRINGcassava4.1_022967m1e-138(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-69LOB domain-containing protein 1