PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.04G017500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 807aa    MW: 89277.1 Da    PI: 7.696
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.04G017500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.9e-096076441954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Manes.04G017500.1.p 607 FEHflHPYPSDTDKHMLATQTGLSRNQVSNWFINARVR 644
                          664459******************************87 PP

2BELL105.53.6e-34461531272
                 BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          r e q+kkakLl l+eeV++rYkqy++q+q+v+ssFe vagl +a+pY+slAlk++Sr+Frc++ ai++q+
  Manes.04G017500.1.p 461 RSEYQQKKAKLLYLQEEVCHRYKQYHQQMQMVASSFESVAGLSTATPYVSLALKTVSRNFRCVRHAISDQL 531
                          6799****************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.3E-46382529IPR006563POX domain
PfamPF075261.6E-40387528IPR006563POX domain
PROSITE profilePS5007111.936585648IPR001356Homeobox domain
SMARTSM003893.2E-8588652IPR001356Homeobox domain
CDDcd000864.94E-11588649No hitNo description
SuperFamilySSF466898.98E-17590654IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-27591652IPR009057Homeodomain-like
PfamPF059203.1E-18605644IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 807 aa     Download sequence    Send to blast
MDTSSFRPGE SHVAQQSRRD KLRVQASSAS AAHHLDDFSN NLEQLSVHSG LNPDLVQVRN  60
VRNASILYDP TTTVFSSEML NFATRSTGVL PAQRHAMADQ ELAAMTHNMS HPVSSNIKAN  120
SSDPQACSNW RSSDTQQCYD WMVNYASGSS VGRENNQKPI FVGDVLSNNA RVTDISTPTQ  180
YVKPIYDGYQ SVQSSLAIPS SEIHGQGSQR QHREMQFASH MHPFYHNTLA DVVTSASNAY  240
GNHSTALCFD NANTWMNRPV ESCHQWSSEM GLVTRKNSQE LRTLARDPNT QVLSLSLSSN  300
PPSRGNITQF EEGYESEHMQ SKPGELKESH NQDSKILKSS NYLCSMSKPA IISRSAGKSL  360
SDMVGTSNYN VLQNAGPLGP FTGYATILKS SKFLKPAQQL LDEFCRAAGL KLLKTCEGSA  420
RISGDCAETG AKVNNTTFYS SNEVSGDVAV AVASSTCESL RSEYQQKKAK LLYLQEEVCH  480
RYKQYHQQMQ MVASSFESVA GLSTATPYVS LALKTVSRNF RCVRHAISDQ LKHVAKALGE  540
DLLSPNTGTS SSKGDTSTSR LKYTDQNFQR YRCGGANAGF FESQQHVWRP QRGLPERSVA  600
ILRAWLFEHF LHPYPSDTDK HMLATQTGLS RNQVSNWFIN ARVRVWKPMV EEIHMLETKG  660
LAENQTYANL EGKSVEGTSH PLQEQSSNNI GADSMLNKQL ECSGTGSSSG SGEHLDAEQW  720
SQEKRSRIEF QAPTSMDGSV MNFLPYQRTS GVDIGGLGAV SLTLGLRHGV ENAQHQQPHQ  780
QHPQLQQRED QHRRRFGGQM IHDFVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-16594652563Homeobox protein Meis2
3k2a_B6e-16594652563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002529426.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLB9STV70.0B9STV7_RICCO; Bel1 homeotic protein, putative
STRINGPOPTR_0009s01520.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34813257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.17e-96BEL1-like homeodomain 8