PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G201000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family ARR-B
Protein Properties Length: 656aa    MW: 71798.4 Da    PI: 5.0927
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G201000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.47.9e-29214267155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Manes.03G201000.1.p 214 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 267
                          79*******************.********************************8 PP

2Response_reg75.81.6e-25351441109
                          EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHH CS
         Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedale 88 
                          vl vdD+++ +  l+++l +  y ev+ ++d+e al ll++++  +D++l D+ mp+mdG+ell++i  e ++lp+++++  +e++++ +
  Manes.03G201000.1.p  35 VLAVDDNQTCLLTLEKMLMSCLY-EVTKCSDAETALSLLRQNRngYDIVLSDVHMPDMDGFELLEQIVLEMDDLPVVMMSYDEEKNMVMK 123
                          799********************.***************99999***********************99899****************** PP

                          HHHTTESEEEESS--HHHHHH CS
         Response_reg  89 alkaGakdflsKpfdpeelvk 109
                           +  Ga d+l Kp+ +e l +
  Manes.03G201000.1.p 124 GITQGACDYLIKPVGIETLKN 144
                          *****************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.6E-16414647IPR017053Response regulator B-type, plant
SuperFamilySSF521721.85E-3332158IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.1E-3932176No hitNo description
SMARTSM004481.1E-2733146IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011039.98834150IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-2235144IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.07E-2536149No hitNo description
PROSITE profilePS5129411.048211270IPR017930Myb domain
SuperFamilySSF466893.4E-20211271IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-30213272IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-25214267IPR006447Myb domain, plants
PfamPF002499.3E-8216266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MDPNSGKGSL PTSSSSGAWK AEDLVDDKFP VGLRVLAVDD NQTCLLTLEK MLMSCLYEVT  60
KCSDAETALS LLRQNRNGYD IVLSDVHMPD MDGFELLEQI VLEMDDLPVV MMSYDEEKNM  120
VMKGITQGAC DYLIKPVGIE TLKNIWQHVV RKKRNAWKHL EQSGSVEDGD RQHKQSQDTD  180
YSYSANGGNW RNSKKKKGEE EEAEERDNTS TLKKPRVVWS VELHQQFVAA VNQLGIDKAV  240
PKKILELMNV PGLTRENVAS HLQKYRLYLR RLSGASQHQS NLNNGFICPQ EATYGPMSSF  300
NGIDLQTLAA TGQLPAQSLA TLQAAGLGQS RIPMPMVDQR NHFSFENPEL RLGEGQQQQL  360
SSSKLNLHGI PTTMEPKQLA NLHHSAQPLG SMNVEVNAHG GQNNSLLMQM SQSQSRGQTL  420
NETTGSHLPI LPSSMAQPVL SNPVVSEVIA RNGLAENGRG SVYNLVSQSS SMLNFPLNSA  480
AELSGNSLPL VSSLTSNPEM KGSVGFMPSY DIFSDLNQHK SHDWELGMNF NASQQNNSLQ  540
SNLNVGPSVL PHQGFSSSQR IGLNISAVGK PMFTAEDASA HVNAQHFGQV NTFFSDNSAS  600
VKPEIVSDAS CQTTLFPEQF GQEDLMSTLL KQQQGGVPAE NEFDIDGSPL DDIPQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-22213273464ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:15282545, ECO:0000269|PubMed:16407152}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.03G201000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021607816.10.0two-component response regulator ARR2-like
SwissprotQ9ZWJ91e-180ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A2C9WAU20.0A0A2C9WAU2_MANES; Two-component response regulator
STRINGcassava4.1_033460m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-168response regulator 2
Publications ? help Back to Top
  1. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  2. Ge XM, et al.
    Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis.
    Plant J., 2015. 82(1): p. 138-50
    [PMID:25704455]
  3. Takahashi N,Umeda M
    Cytokinins promote onset of endoreplication by controlling cell cycle machinery.
    Plant Signal Behav, 2014. 9(8): p. e29396
    [PMID:25763620]
  4. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  5. Arnaud D, et al.
    Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(3): p. 543-559
    [PMID:28254779]
  6. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  7. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  8. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  9. Takatsuka H,Higaki T,Umeda M
    Actin Reorganization Triggers Rapid Cell Elongation in Roots.
    Plant Physiol., 2018. 178(3): p. 1130-1141
    [PMID:30185441]