PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G049500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family HSF
Protein Properties Length: 349aa    MW: 39437 Da    PI: 4.525
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G049500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind77.62e-2436104371
                          HHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBT CS
         HSF_DNA-bind   3 lkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekk 71 
                          l+++ye++ed+++++++sws+  nsf+v+d+++f++++LpkyFkh+nf+SF+RQLn+Y     + ++++
  Manes.03G049500.1.p  36 LHETYEMVEDPSTDSVVSWSRAHNSFIVWDSHKFSTTLLPKYFKHNNFSSFIRQLNTYKHLLKTIKRRR 104
                          799*******************************************************97544444333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004153.6E-2431103IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.104.7E-253195IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000562.7E-123558IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467855.44E-2136103IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004476.4E-2136101IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.7E-127385IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.7E-128698IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MDGVVVKEEK ETVTCAGGLS SSSSSSSFQP QPMEGLHETY EMVEDPSTDS VVSWSRAHNS  60
FIVWDSHKFS TTLLPKYFKH NNFSSFIRQL NTYKHLLKTI KRRRHISQSM QQQSGGPCVE  120
VGEFGLEGEL ERLKRDRGVL MAEIIKLRHQ QQQSREQIAA MEDRLQSTER KQQQIMTFLA  180
KALNNPSFVQ QLSMKGTQMR EVRGVEIGRK RRLMASPSLE NLQDEAASMV MDTSQALDYT  240
NQELGTTETE IDTLFLATFD DESSSDVRDP IGGSTQGTSM DNWGSVNETI WEELLNDDVI  300
AGNPNEEIIL EDELEFDVKV EDLVAKPDDW GEELQGLVDR MGYLRSKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B2e-15361093098Heat shock factor protein 1
5d5v_B2e-15361093098Heat shock factor protein 1
5d5v_D2e-15361093098Heat shock factor protein 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196102LKTIKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012077263.11e-175PREDICTED: heat shock factor protein HSF30 isoform X1
SwissprotP411521e-107HSF30_SOLPE; Heat shock factor protein HSF30
TrEMBLA0A067KQI11e-177A0A067KQI1_JATCU; Uncharacterized protein
STRINGPOPTR_0006s24330.11e-158(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82253143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26150.11e-82heat shock transcription factor A2