PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G032000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family HRT-like
Protein Properties Length: 497aa    MW: 54818.7 Da    PI: 9.1461
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G032000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like56.45e-18276305231
             HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                          CG+i++dG++C+r+Pv+gRKRCe HKGm+i
  Manes.03G032000.1.p 276 CGFIMNDGIPCRRPPVPGRKRCESHKGMKI 305
                          ****************************97 PP

2HRT-like57.32.6e-18333362231
             HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                          CGv+l+dG++C++q+++gR+RCeeHKGmR+
  Manes.03G032000.1.p 333 CGVNLGDGNFCMKQAMPGRQRCEEHKGMRV 362
                          *****************************7 PP

3HRT-like44.72.2e-14415443129
             HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGm 29 
                          +CG++l++GsvC+r+P +g+ RC++HKG+
  Manes.03G032000.1.p 415 VCGATLGNGSVCRRKPSQGNERCWQHKGK 443
                          7***************************6 PP

4HRT-like53.83.3e-17461491131
             HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                          +C v+l+dGsvC+r Pv+gRKRCe HKGmR+
  Manes.03G032000.1.p 461 TCRVALQDGSVCMRVPVHGRKRCELHKGMRV 491
                          799***************************7 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MADGDKSAVP TASSTRLKSE DYKRTKHDSH FSKWQVLIGP SDWDDYSQRK EGAARYRVHN  60
LPTSSGPGLY ELGIAVSRSG LGRLVGKLDP DDIVVVYLGQ ADNVRSRLQS YGRSGAHLGN  120
SYATGHWDSS NGSPQKGPRL FEEIFAGGHS IVFRWASMKD KRNAEKTEAL LLDTFDYAWN  180
KGCNCARRPD DILQKICEIA SSTRRFSSIS KRLLFLRPNQ VGIKIEANKP LSPEKCTIPA  240
DEDGKSFFKG IFKFSRWQPR LVSDKCGIDE DLIHRCGFIM NDGIPCRRPP VPGRKRCESH  300
KGMKIYRYSS KPISEGNSSD LPGVHLDSCT NSCGVNLGDG NFCMKQAMPG RQRCEEHKGM  360
RVNSSKPLAE EKFHPANNGS VDWTDNNASS GSNMDQGLQF HSSNESSIDE PCSSVCGATL  420
GNGSVCRRKP SQGNERCWQH KGKSGGSNLS NSSIPSLDTI TCRVALQDGS VCMRVPVHGR  480
KRCELHKGMR VFTSFN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.03G032000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021606866.10.0protein EFFECTOR OF TRANSCRIPTION 2
TrEMBLA0A2C9W4490.0A0A2C9W449_MANES; Uncharacterized protein
STRINGcassava4.1_024956m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF94093139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.11e-111effector of transcription2