PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G020700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family M-type_MADS
Protein Properties Length: 338aa    MW: 38483.3 Da    PI: 9.8468
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G020700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.12.3e-131151343
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                         i n+  r +t+ kR++g+ KK +E  +LC+++++vii++++
  Manes.03G020700.1.p 11 ITNEKSRMITYQKRKKGLTKKLQEFHILCNVDACVIILGPN 51
                         899***********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.353151IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-13162IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-18284IPR002100Transcription factor, MADS-box
CDDcd001208.89E-17251No hitNo description
PRINTSPR004043.4E-7323IPR002100Transcription factor, MADS-box
PfamPF003197.2E-161151IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRGKLSMEL ITNEKSRMIT YQKRKKGLTK KLQEFHILCN VDACVIILGP NFNNRPVDVE  60
TFPTDRFDMM RIINRYRSQE KEGRKNQDLS SFFVARQKKL DDEIAKLRKA CLKAKFPTWD  120
NRLSLLQSSE LDILSRVLDS KLEVATSRIL NVRGGCSTIN NYKSSSMAST FANALQQKNM  180
ELEVFKKQEP LSFVKPSQNL PQMLPLYVNP LNNPVLMMMM MANGEDYYNQ FVGECSSSSS  240
KRLSWSPVKA PAGSFDHQAC DKVMMVNNNS RAHPVSYCGL SSQPLLSANV SSHMQIPHPQ  300
FNGLSDINEF EIRNKEKTVK DMNLEASIKE RSLQFWS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.03G020700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021606765.10.0agamous-like MADS-box protein AGL8
TrEMBLA0A2C9W3Y10.0A0A2C9W3Y1_MANES; Uncharacterized protein
STRINGcassava4.1_023010m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.16e-21M-type_MADS family protein