PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G011800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 431aa    MW: 47863.1 Da    PI: 6.4336
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G011800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.49.9e-083784112154
                          HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          k +yp++e++++L +++gL+ +q+ +WF N+R +
  Manes.03G011800.1.p 378 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 411
                          569*****************************87 PP

2ELK26.41.6e-09332353122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ELKh+L+++Y++++ ++++E++
  Manes.03G011800.1.p 332 ELKHELKHGYKEKIADIREEIL 353
                          9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.1E-20164208IPR005540KNOX1
PfamPF037901.2E-17166207IPR005540KNOX1
SMARTSM012561.2E-27220275IPR005541KNOX2
PfamPF037914.4E-20225274IPR005541KNOX2
SMARTSM011880.0047332353IPR005539ELK domain
PROSITE profilePS512139.69332352IPR005539ELK domain
PROSITE profilePS5007111.726352415IPR001356Homeobox domain
SuperFamilySSF466894.19E-16354417IPR009057Homeodomain-like
SMARTSM003894.5E-11354419IPR001356Homeobox domain
CDDcd000861.45E-11355416No hitNo description
Gene3DG3DSA:1.10.10.605.2E-25359416IPR009057Homeodomain-like
PfamPF059201.3E-17372411IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MAFHHNLSQD LPLHHFSSEQ TQPPRQQNMP ETTAAPNWLN NALLRAQHPQ PPPHSHFTGD  60
TNFLNLHTAS TTNSDSTASQ NHTQWLSRSS SFLNRNHSDV IDDVTVATAG DSIIAGTISH  120
ESADLKTNIN NNGETMNNKS EGGVFESGGG GGGGGDGVVN WQNARYKAEI LSHPLYDQLL  180
SAHVACLRIA TPVDQLPRID AQLAQSQHVV AKYSALGGGT QGLVVDDKEL DQFMTHYFLL  240
LCSFKEQLQQ HVRVHAMEAV MACWEIEQSL QSLTGVSPGE GTGATMSDDD EDQVDSDANL  300
FDPSFDGSDT MGFGPLIPTE SERSLMERVR HELKHELKHG YKEKIADIRE EILRKRRAGK  360
LPGDTTSVLK AWWQSHAKWP YPTEEDKARL VQETGLQLKQ INNWFINQRK RNWHSNPSTS  420
TVLKSKRKRS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A2e-12355419872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1408428RKRNWHSNPSTSTVLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012076472.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
RefseqXP_012076473.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
RefseqXP_012076474.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A067KBM70.0A0A067KBM7_JATCU; Uncharacterized protein
STRINGGLYMA04G06810.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.20.0KNOTTED1-like homeobox gene 3