PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G005400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family B3
Protein Properties Length: 582aa    MW: 66984.6 Da    PI: 9.6381
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G005400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.93.9e-1820981098
                         HHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                   B3 10 vlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                          +k++++++p +f+ ++ +g+k      +l+ ++g+ W vk+  + +s    +++GWk+Fv++++L +gDf+vF+++g++ f   v+vf+
  Manes.03G005400.1.p 20 GFKHQQFSIPVSFF-KYlKGQK--CERAILRGRTGKIWPVKI--NSRS----FEDGWKDFVEDHDLHVGDFLVFRHEGEMVF--DVMVFE 98
                         68999*********.5547774..3479**************..7776....9**********************9999998..777776 PP

2B369.44.8e-22162253396
                          EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                   B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                           v ++s++ k++ l +p kfa++hg+ + ++ +++l++e+grsW     + +k++g++++++GW +F +an+Lk+gD+++Fk+++ +++ 
  Manes.03G005400.1.p 162 VVKLTSYSAKRCKLHIPIKFARTHGLCN-SNCKMILMNEKGRSWPAVS-WnKKSDGQVYIGRGWTSFRDANNLKAGDSFIFKHIE-KQKI 248
                          55669*******************8774.5669************999.62555555*************************997.5555 PP

                          .EEEE CS
                   B3  92 lvvkv 96 
                          +++k+
  Manes.03G005400.1.p 249 PTFKF 253
                          66665 PP

3B345.91e-14333422395
                          EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                   B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                           + ++s+   +++l++p +fa+ +++++++  +++l d +grsW  kl ++ ++gr ++   W+ F  an+L  gD+++++l++ +++ +
  Manes.03G005400.1.p 333 VAKVTSYGACRSILYIPTTFARLNNLNNRR-CKMILVDAKGRSWPAKLWHKTSDGRAYIH-DWNAFRVANDLHPGDSFILELVD-KGEMP 419
                          56679*******************999766.59***************667777788888.9*******************987.66656 PP

                          EEE CS
                   B3  93 vvk 95 
                          v+k
  Manes.03G005400.1.p 420 VFK 422
                          665 PP

4B355.21.3e-17455542494
                          E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
                   B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                          v++++++ +++ l +p +fa++++++ ++s +++l++e+g+sW v l  ++k+g+++++ GW+eF+kangL+e+ +++++l++  + ++ 
  Manes.03G005400.1.p 455 VTVKAYHIQNSYLQIPSDFARRNDLIGKCS-EMILTNERGNSWVVSL-ETGKDGKVYIGCGWSEFAKANGLRERNIFMLELVE-GGNKPA 541
                          667899999**************9997676.****************.4777778*************************986.444455 PP

                          E CS
                   B3  94 v 94 
                          +
  Manes.03G005400.1.p 542 M 542
                          4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.9E-238102IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.14E-218102IPR015300DNA-binding pseudobarrel domain
CDDcd100174.87E-181197No hitNo description
SMARTSM010195.0E-1713100IPR003340B3 DNA binding domain
PfamPF023624.3E-142196IPR003340B3 DNA binding domain
PROSITE profilePS5086312.74628100IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.7E-21156253IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.41E-20157254IPR015300DNA-binding pseudobarrel domain
CDDcd100172.16E-19159255No hitNo description
SMARTSM010193.7E-21160257IPR003340B3 DNA binding domain
PROSITE profilePS5086313.126160259IPR003340B3 DNA binding domain
PfamPF023625.1E-20161255IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.6E-16327423IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.94E-16329422IPR015300DNA-binding pseudobarrel domain
CDDcd100178.45E-16330422No hitNo description
PROSITE profilePS5086311.42331426IPR003340B3 DNA binding domain
SMARTSM010191.6E-12332427IPR003340B3 DNA binding domain
PfamPF023626.7E-12334422IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.3E-19444538IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-18450543IPR015300DNA-binding pseudobarrel domain
CDDcd100171.28E-14451545No hitNo description
SMARTSM010191.6E-14452548IPR003340B3 DNA binding domain
PROSITE profilePS5086313.676452548IPR003340B3 DNA binding domain
PfamPF023621.1E-15454543IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MATEKILSSK PHFLQPVLPG FKHQQFSIPV SFFKYLKGQK CERAILRGRT GKIWPVKINS  60
RSFEDGWKDF VEDHDLHVGD FLVFRHEGEM VFDVMVFESS ACLREYPSFP AKEFDIKEEE  120
IEFQEEQLAQ KSSPEKYNKK EQNRTTLQGK AATSVHEQHY FVVKLTSYSA KRCKLHIPIK  180
FARTHGLCNS NCKMILMNEK GRSWPAVSWN KKSDGQVYIG RGWTSFRDAN NLKAGDSFIF  240
KHIEKQKIPT FKFHRFYEGL LQANTEAKME PTYQEVHAGS LSIRHHHISV SKKKTAEEVE  300
KECRPRKPKK KQQCATNYEV KASSSVLEQP YFVAKVTSYG ACRSILYIPT TFARLNNLNN  360
RRCKMILVDA KGRSWPAKLW HKTSDGRAYI HDWNAFRVAN DLHPGDSFIL ELVDKGEMPV  420
FKMSMMKVNT KTDSEMIHQD GEASSSSIRH PYFYVTVKAY HIQNSYLQIP SDFARRNDLI  480
GKCSEMILTN ERGNSWVVSL ETGKDGKVYI GCGWSEFAKA NGLRERNIFM LELVEGGNKP  540
AMKFYGVEQR TAGNKISYKD SAQRISFENC EDVKPIIQHP E*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.03G005400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021607556.10.0putative B3 domain-containing protein REM15 isoform X3
TrEMBLA0A2C9W3G20.0A0A2C9W3G2_MANES; Uncharacterized protein
STRINGcassava4.1_031416m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16161410
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.16e-62B3 family protein