PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.02G180900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 115aa    MW: 12925.3 Da    PI: 8.8389
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.02G180900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260522e-1667113147
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47 
                          +Ca C +lrr+ a++Cvla+yfp  +pkkf ++h++FGasn++k+l+
  Manes.02G180900.1.p  67 PCATCEILRRRSAEKCVLARYFPLIEPKKFTIAHRVFGASNIIKFLQ 113
                          7********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089114.76466114IPR004883Lateral organ boundaries, LOB
PfamPF031956.4E-1567113IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MHCRLLISDH EVTLSNLLPP FHTVVDYSQK DREVCYRPLS SSAVAPSSLV ELLIGRSSRC  60
CRCCLSPCAT CEILRRRSAE KCVLARYFPL IEPKKFTIAH RVFGASNIIK FLQL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.02G180900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2C9WFD23e-76A0A2C9WFD2_MANES; Uncharacterized protein
STRINGcassava4.1_032310m2e-76(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-20LOB domain-containing protein 1